Which of the following distinguishes which bioengineer is studying a topic beneficial to agriculture
and correctly explains why?
Bioengineer A is studying how to make cows gain more mass from smaller amounts of food.
Bioengineer B is studying the process of how cows digest food.
Bioengineer A, because farmers are running out of fields to let their cows graze,
Bioengineer B, because a cow's digestive process helps scientists understand human digestion
Bioengineer B, because many cows suffer from deadly digestion problems,
O
Bioengineer A, because a cow with more mass can provide more food to the population

Answers

Answer 1

Answer: Bioengineer B, because many cows suffer from deadly digestion problems

Explanation:

Answer 2

Answer:

Bioengineer A, because a cow with more mass can provide more food to the population

Explanation:

I did it on edge.


Related Questions

What are some of the natural barriers to species movement/migration that isolate them and create habitat islands?

Answers

Answer:

Mountains and Oceans

Explanation:

There are various natural barriers that prevent species from migrating such as Mountains and Oceans. If a species does not have the physical requirements to swim across an ocean or climb over a mountain it completely prevents them from passing such a barrier and moving to another geographical location to establish a new habitat. This ultimately causes them to stay in place and create a habitat island. There are many other natural barriers as well such as valleys, and rivers, waterfalls, and even weather effects such as snow habitats which some animals can't survive in.

In your own words, explain how whales impact (either positively or negatively) the carbon cycle. HURRRY !!!!

Answers

Answer: Hey There Zachary~ Here to help

When humans hunt animals they tend to favor animals that provide significant resources, like whales and sharks. Now this has a negative effect on species ecosystems, and can also impact the climate, like when whales and other large animals flourish in the ocean they carry a substantial amount of carbon to the sea floor upon dying, and whales like other large marine vertebrates can effectively function as carbon credits. Although whales can cause a negative effect they can also make a positive effect, ever heard of "Bigger is better"? well when it comes to whales bigger is naturally better! Body size is critical to our arguments true but  the amount of carbon stored in living whales and the amount exported in sinking carcasses is unbelievabley great! See now i know your thinking "How does a dying whale sound great?" well the shift toward smaller animals can decrease the total amount of biomass by 30% vertebrates because vertebrates can efficiently export carbon from surface waters to the deep seas.

Sincerely Zachary~

True or false is points a and q collinear?

Answers

Answer:

True

Explanation:

This is because both points are on the same line.

Hope this helps!

Wha was the Texas Revolution and what impact did the Texas revolution have on the United States?

Answers

Answer:

The founding of the republic of texas.

Explanation:

Texas Revolution, also called War of Texas Independence, war fought from October 1835 to April 1836 between Mexico and Texas colonists that resulted in Texas's independence from Mexico and the founding of the Republic of Texas (1836–45).

Answer:

The founding of the republic of texas.

Explanation:

Texas Revolution, also called War of Texas Independence, war fought from October 1835 to April 1836 between Mexico and Texas colonists that resulted in Texas's independence from Mexico and the founding of the Republic of Texas (1836–45).

I need to find Y, process?

Answers

Answer:

If you look at Y and compare it to 120, Y looks as if it is half of what the angle measurement 120 is. So you would do 120 divided by 2 (to get half of 120) and you end up with 60. We can infer that the top left angle measures 60. So, you do 60 divided by 5 (since you are looking for Y but there is a 5 in front of it so you would multiply 5 and Y to get 60. You need to do the inverse operation which is divide.) So you divide 60 and 5 and get 12. Replace Y with 12 and you have 5(12). The answer is Y=12

Explanation:

Hope this helps!

Can someone actually help me before I give up!!!!!!!!!75POINTS5

AND IF YOU POST JUST FOR POINTS I WILL REPORT YOU TILL YOUR BOOTED OFF

Answers

Answer:

1. 94 degrees

2. 86 degrees

3. 111 degrees

4. 69 degrees

5. 121 degrees

Explanation:

I won't go into full detail, because that would take too long. To solve any of these kind of problems, you just need to know two things:

1. The 3 angles of every triangle always add up to 180 degrees.

2. The angles on one side of a straight line always add up to 180 degrees.

For example, I figured out #1 because I figured out that the third angle of the bottom left triangle was 86 degrees. Angle #1 is the only other angle sharing the same line as the 86 degree angle, so I did 180-86 to get 94 degrees. I just went from there, using the two rules I listed above.

I hope this helps! Please feel free to give me Brainliest if you feel that this helped your understanding of the problem.

Answer:

1) 94 deg.

2) 86 deg.

3) 111 deg.

4) 69 deg.

5) 121 deg.

Hey guys im in highshcool doing test and i need answer for 1+1

Answers

Answer:

0

Explanation:

Just get good

I’m not sure but I think it’s 2 . I think

In the passage, polyptoton is utilized with which of the following words?
I dedicate
II. dead
III. conceived
A.
I only
B. ll only
C. I and II
D. I and III
E. I, II, and III

Answers

Answer:

I think it's C

Explanation:

I'm not 100% sure though

What are your responsibilities as the owner of a vehicle?

Answers

Answer:

to not destroy it and not to drink and drive

Explanation:

Which is complaner?
True
False

Answers

True is the answer have a great day

Democracy is defined by the fact that goverment gets it power from

Answers

Democracy is defined by the fact that the government gets its power from the WILL OF THE PEOPLE.

In a DIRECT democracy,all citizens take part in government policy by voting on issue and they are used by countries with small populations. while in a REPRESENTATIVE democracy,citizens choose people to act on their behalf in government and they are used by countries with large population.

Democracy is gotten from a Greek word DEMOS which means PEOPLE.

It is basically government OF the people, BY the people and FOR the people. This people talked about in democracy are the ones that legally live in a particular country where democratic system of government is practiced.

Democracy has its main goals which are to protect the people,provide for the common good of the people, maintain order and balance and protect lives,liberty and the pursue of happiness.

Lifting a 2 kg chair with a force of 500 newtons causes an
acceleration of what?

Answers

Answer:

C.

Explanation:

Please mark me brainliest!!!

Pretend that you are a high school college counselor. Write a formal letter to their high school students, who are prospective college applicants, about the importance of a positive digital footprint. As a college counselor, you should give concrete tips and examples for curating a positive online presence, as well as caution about the possible consequences of a negative digital footprint.

Answers

Answer:

In order, keep yourself safe on the internet you should be aware of something called a digital footprint that can keep track of you and there are some steps and steps to keep yourself safe online nothing hard just simple things you should follow. Saftey steps include having a password that only you should know and your parents cause you cant give your password to friends because there are friends you think u can trust but you can trust only your parents, as well there is another step that you have to keep your digital footprint safe also know as cookies on the internet browsers According to building a digital footprint. According to paragraph 4, your digital footprint is important it is part of you, and many others in the world footprint u leave online will always stay there it isn't like snow and disappear it will be there forever.

Explanation:

i only did rac forgot to do e here you go if this help go follow my instgram dummbyy.brandon

How did technology develop as a result of trade?

Answers

Technology helped in the development of new technological innovations such as a saddles, boats, compass, which made it possible for merchants to trade.

The ______ lobe contains the primary sensory cortex, which controls sensations such as touch or pressure.
O occipital
O parietal
O temporal
O frontal​

Answers

Answer:

parietal

Explanation:

parietal does this

The correct option is B. The parietal lobe contains the primary sensory cortex, which controls sensations such as touch or pressure.

The postcentral gyrus, which is where the primary somatosensory cortex (SI) is found, is situated in the frontal region of the parietal lobe.

What is the primary somatosensory area?

The parietal lobe of the brain is home to the primary and secondary somatosensory cortexes, or S1 and S2, respectively. By way of the internal capsule and corona radiata, the primary somatosensory cortex, which is situated directly behind the central sulcus, gets sensory data from the thalamic VPL.

The central sulcus places the parietal lobe behind the frontal lobe. The parietal lobe contains regions that are in charge of integrating sensory data such as touch, pressure, temperature, and pain.

Thus, The best choice is B. The primary sensory cortex, which regulates feelings including touch and pressure, is located in the parietal lobe.

Learn more about the parietal lobe here:

https://brainly.com/question/14567052

#SPJ2

you throw a ball with a mass of 2.5kg. the ball leaves your hand at 20 m/s. How much kinetic energy does the ball possess.

A. 100 J
B. 300 J
C. 500 J
D. 600 J

Answers

Answer:

500 J

Explanation:

[tex]K.E = \frac{1}{2} mv {}^{2} \\ \\ K.E = \frac{1}{2} \times 2.5 \times (20) {}^{2} \\ \\ K.E = \frac{1}{2} \times \frac{25}{10} \times 20 \times 20 \\ \\ K.E = 25 \times 20 \\ K.E = 500j[/tex]

Can someone help me with this literally will kiss you if you do<3

Answers

Answer:

1    a

2   c

3       e

4      d

5     b

Explanation:

Answer:

1.A

2.C

3.E

4.D

5.B

Explanation:

Describe one policy enacted by the U.S. government in response to globalization.​

Answers

Answer:

Are there answers

for the question

Explanation:

75 points please i need someone to actually answer

Answers

Answer:

Kinda late

Explanation:

The seismic waves that travel through Earth’s interior are _____ waves.

Answers

Answer:

The types that travel through the interior of the Earth are P-waves (primary) and S-waves (secondary). P-waves are longitudinal waves (the displacement of the medium is in the same axis as the direction of propagation).

Explanation:

Answer:

seismic waves are also called earthquake waves.

Explanation:

Or if you're referring to the name of the waves on the inside of the earth, they're called body waves or primary waves because they come first. as opposed to surface waves which arrive after.

WILL GIVE MORE POINTS IF YOU ANSWER ALL MY QUESTIONS CORRECTLY (500 points plus 10 for each other question)
Every morning I lay on the floor in the front parlor watching her door. The blind was pulled down to within an inch of the sash so that I could not be seen. When she came out on the doorstep my heart leaped. I ran to the hall, seized my books and followed her. I kept her brown figure always in my eye and, when we came near the point at which our ways diverged, I quickened my pace and passed her. This happened morning after morning. I had never spoken to her, except for a few casual words, and yet her name was like a summons to all my foolish blood.
Her image accompanied me even in places the most hostile to romance. On Saturday evenings when my aunt went marketing I had to go to carry some of the parcels. We walked through the flaring streets, jostled by drunken men and bargaining women, amid the curses of labourers, the shrill litanies of shop-boys who stood on guard by the barrels of pigs’ cheeks, the nasal chanting of street-singers, who sang a come-all-you about O’Donovan Rossa, or a ballad about the troubles in our native land. These noises converged in a single sensation of life for me: I imagined that I bore my chalice safely through a throng of foes. Her name sprang to my lips at moments in strange prayers and praises which I myself did not understand. My eyes were often full of tears (I could not tell why) and at times a flood from my heart seemed to pour itself out into my bosom. I thought little of the future. I did not know whether I would ever speak to her or not or, if I spoke to her, how I could tell her of my confused adoration. But my body was like a harp and her words and gestures were like fingers running upon the wires.

One evening I went into the back drawing-room in which the priest had died. It was a dark rainy evening and there was no sound in the house. Through one of the broken panes I heard the rain impinge upon the earth, the fine incessant needles of water playing in the sodden beds. Some distant lamp or lighted window gleamed below me. I was thankful that I could see so little. All my senses seemed to desire to veil themselves and, feeling that I was about to slip from them, I pressed the palms of my hands together until they trembled, murmuring: “O love! O love!” many times.

At last she spoke to me. When she addressed the first words to me I was so confused that I did not know what to answer. She asked me was I going to Araby. I forgot whether I answered yes or no. It would be a splendid bazaar, she said she would love to go.

“And why can’t you?” I asked.

While she spoke she turned a silver bracelet round and round her wrist. She could not go, she said, because there would be a retreat that week in her convent. Her brother and two other boys were fighting for their caps and I was alone at the railings. She held one of the spikes, bowing her head towards me. The light from the lamp opposite our door caught the white curve of her neck, lit up her hair that rested there and, falling, lit up the hand upon the railing. It fell over one side of her dress and caught the white border of a petticoat, just visible as she stood at ease.

“It’s well for you,” she said.

“If I go,” I said, “I will bring you something.”

What innumerable follies laid waste my waking and sleeping thoughts after that evening! I wished to annihilate the tedious intervening days. I chafed against the work of school. At night in my bedroom and by day in the classroom her image came between me and the page I strove to read. The syllables of the word Araby were called to me through the silence in which my soul luxuriated and cast an Eastern enchantment over me. I asked for leave to go to the bazaar on Saturday night. My aunt was surprised and hoped it was not some Freemason affair. I answered few questions in class. I watched my master’s face pass from amiability to sternness; he hoped I was not beginning to idle. I could not call my wandering thoughts together. I had hardly any patience with the serious work of life which, now that it stood between me and my desire, seemed to me child’s play, ugly monotonous child’s play.

What is suggested by the interaction between the boy and the girl?

A. a dearth of friends for both the boy and the girl

B. a conflict between the boy and the girl

C. an unrecognized attraction between the boy and the girl

D. a disconnect between the boy’s dream and the reality of the situation

E. a discomfort with public displays of affection

The word “annihilate” in the second sentence of paragraph 9 is used to imply that the boy

A. will destroy anything in his reach

B. feels empowered and anxious

C. has been defeated by the world around him D. has conquered his feelings for the girl

E. will rebel against his aunt

Answers

Answer: d

Explanation: ok

Piper invested $7,400 in a Certificate of Deposit, $4,980 in a corporate bond, $5,100 in a common stock, and $6,350 in a preferred stock, The COD has a rate of return of 3.4%; the corporate bond is 5.8%; the common stock's rate of return is -1.9%; and the preferred stock has a rate of return of 4.6%.

What is Piper's weighted mean rate of return? (2 points)

Answers

Answer:

3x−2y=12

Explanation:

What were the advantages and disadvantages to Pastoralism

Answers

Answer:

One of the greatest advantages of pastoralism is that it places no burden on groundwater resources. It requires no irrigation and, during the rainy season, animals can often obtain all their water needs from the plants that they ingest.

Disadvantages:-

Some of the pastoral farmers have to buy food for their animals, which can be quite expensive. ... Problems with financial and insurance services. ... Overgrazing of the pastoral area can lead to many problems including land erosion and destruction of the vegetation of the land.

Identify 3 sources of water pollution.

Answers

Answer:

he took my answer XD

Explanation: But its

Sewage

Agriculture pollution

Oil pollution

As air rises, it transfers heat from the surface of Earth to the upper levels of the atmosphere in a process called . Scientists have found that the most destructive and deadly tornadoes occur from rotating thunderstorms called , which have a well-defined circulation. The effect is what causes the rotation of a hurricane.

Answers

Answer:

1. Convection 2. Supercells 3. Coriolis

Explanation:

I took the assignment

As air rises, it transfers heat from the surface of the Earth to the upper levels of the atmosphere in a process called Convection.Scientists have found that the most destructive and deadly tornadoes occur from rotating thunderstorms called, supercells, which have a well-defined circulation. The Coriolis effect is what causes the rotation of a hurricane.

What is the Coriolis effect?

The Coriolis Effect causes objects traveling great distances around the Earth to appear to move in a curved path rather than a straight line. Examples include planes and air currents.

Convection is the scientific term for the transfer of heat from heated fluids. Rotating updrafts, often known as rotating thunderstorms, are what supercells are. Coriolis is a force that is present in rotating or moving things, according to one definition.

Therefore, the correct options are 1. Convection, 2. Supercells, and 3. Coriolis.

To learn more about the Coriolis effect, refer to the link:

https://brainly.com/question/14290551

#SPJ2

Select all statements that are true about a linear relationship between a response variable and an explanatory variable .


The value of represents the slope of the least-squares regression line.


The relationship can be expressed mathematically in the form =+ where and are constants.


The residual plot based upon the least-squares regression line shows a U-shaped leftover pattern.


The scatter plot looks like a straight line.


The -intercept is the value of when =0 .

Answers

Answer:

C

Explanation:

The linear relationship between two variables exhibits all the characteristics expect the description of the residual given in the option.

Recall :

y = a + bx

Where ;

y = response variable ; x = explanatory variable

a = intercept ; b = slope

Evaluating the options given:

Linear relationships can be expressed in the form y = a + bxThe value of y when x = 0 gives the intercept value of the relationship. b represents the slope Linear relationship yield a straight points plot on a graphThe residual is usually random and not U - shaped. (Not true)

Learn more : https://brainly.com/question/10855803

Based on the passage, which of the following most strongly influenced Dara Shikoh’s religious views?

Answers

Answer:

Hello. You didn't add the passage, but I can help you by showing you that Dara's religious views were influenced by Sufism

Explanation:

Dara Shikoh was the son of Mughal emperor Shah Jahan and would be the heir to the throne, had he not been defeated by a battle, against his brother, who led him to execution.

He was an unorthodox Muslim and had a religious view very influenced by Sufism, which is a strand of Islam focused on mysticism and contemplation that leads the individual to direct, intimate and personal contact with God.

Based on the passage, Dara Shikoh’s religious views were strongly influenced by Sufism.

Sufism simply means a mystical form of Islam. It is the school of practice where the inward search for God is emphasized while materialism is shunned.

Based on the passage, Dara Shikoh was the eldest son of Shahjahan. He seeks to find knowledge and divine love by having direct experience of God. He believed that both Islam and Hinduism spoke the same truth.

In conclusion, the correct option is Sufism.

Read related link on:

https://brainly.com/question/11562917

In your response, be sure to address all parts of the question. Use complete sentences; an outline or bulleted list alone is not acceptable.


Use the passage below to answer all parts of the question that follows.

“In 1683, the Kangxi emperor of China asked that I and two other Jesuit fathers accompany him on a journey from Beijing to the Mongol and Turkic regions beyond the Great Wall with 60,000 cavalry and members of the court on a hunting expedition. The emperor wanted to keep the military in constant movement during peace and prepare it for war. He also wanted to prevent his Manchu and Turkic troops from becoming infected by Chinese luxury and, further, to keep the peoples of the region in obedience.

The emperor has divided the immeasurable districts beyond the Wall into forty-eight provinces and has made them all subject and tributary. Thus, he is sovereign of the Chinese and the nomads and could be justly called the greatest and mightiest ruler in the world. Indeed, the emperor chastises offenders of the highest and lowest classes with impartiality according to their misdeeds and he alone makes decisions after considering the advice of his imperial council and hearing the sentences of the imperial law courts. On this account, men of all rank stand in his presence with deep awe and recognize him as sole ruler.”

Ferdinand Verbiest, Flemish Jesuit missionary, adviser, and astronomer at the court of the Kangxi emperor of the Qing dynasty, letter to fellow Jesuits in Europe, 1683

a) Identify ONE way in which the passage illustrates the development of China in the seventeenth and eighteenth centuries.

b) Identify ONE other state in the period 1450–1750 that used methods of rule similar to those described in the passage.

c) Explain ONE factor that might have contributed to Verbiest’s view of the emperor in the second paragraph.

Answers

Answer:

a. The Manchu conquered the Ming dynasty early in the seventeenth century and created the Qing dynasty. The Qing dynasty ruled over more land than the Ming because the Manchu were a combination of nomadic Mongols and Turks above China. So the Qing dynasty ruled over what was the Ming empire and also the nomadic people above them.

b. Like the Qing dynasty the Ottoman empire was a strong military power. Both of their militaries were well mobilized. The Ottoman army consisted of Janissaries, Balkan Christian boys, who became great soldiers and bureaucrats. This is similar to how the author of this letter, a Flemish Jesuit, also became an adviser to the emperor. Both empires were also centralized and required tributary from the people.

c. Verbiest was a Jesuit, a Catholic missionary. He wanted to spread Catholicism to China. He would need to convince the Kangxi emperor to do so. So he could have written the emperor in such a positive way to better his chances of convincing the emperor to convert to Catholicism.  

Explanation: I just had this assignment and my answer was not graded yet but hope it helps.

ONE way in which the passage illustrates the development of China in the seventeenth and eighteenth centuries is:

By showing how the Manchu defeated the Ming dynasty and formed the Qing dynasty

ONE other state in the period 1450–1750 that used methods of rule similar to those described in the passage is:

The Ottoman empire

ONE factor that might have contributed to Verbiest’s view of the emperor in the second paragraph is:

He wanted to get new converts

According to the given passage, we are told of the history of China and how the different dynasties were both conquered and new ones created.

Furthermore, Ferdinand Verbiest is shown to be eager to get new converts, so he has to be polite to the  emperor so that his religioin can be properly diffused.

Read more here:

https://brainly.com/question/16546028


Kaelon believes that most people cannot be trusted. More than not, individuals he has relied on in the past have
failed to do as they promised or were using his generosity to their advantage. Recently, a coworker proposed that he
would help Kaelon move and offered his truck to Kaelon to assist in the move. Kaelon immediately became
suspicious and declined the offer to help, believing his coworker would fail to help him.
Based on this information, we may conclude which of the following?
A. Kaelon's perception is distorted because his coworker really is willing to assist in the move.
B. Kaelon's prior relationship experiences have influenced his perception of his coworker's
behavior.
C. Kaelon is unable to understand his coworker's behavior because he is unable to perceive
altruistic behavior.
D. Kaelon's keen perception is detecting dishonesty in others before it is demonstrated.

Answers

Answer:

B.

Kaelon's prior relationship experiences have influenced his perception of his coworker's  behavior.

Explanation:

As per the given scenario, Kaelon's prior relationship experiences have influenced his perception of his coworker's behavior. The correct option is B.

What is perception?

The organization, recognition, along with the understanding of sensory information in order to show and understand the displayed information or environment is referred to as perception.

All perception implies the transmission of signals via the nervous system, which ultimately resulted from physical or chemical excitation of the sensory system.

Acuity, discrimination, and penetration and may sore are some common synonyms for perception.

Relating perception to our daily lives may be simpler than the way we perceive the world as well as everything around us has a direct impact on our thoughts, actions, also the behavior.

It assists us in relating things to one another and recognizing situations, objects, and patterns.

Kaelon's prior relationship experiences, according to the scenario, have influenced his perception of his coworker's behavior.

Thus, the correct option is B.

For more details regarding perception, visit:

https://brainly.com/question/27164706

#SPJ5

Describe ONE example of a pattern of Mongolian expansion in the period c. 1200-c. 1450.

Answers

Answer:

establishing a trade route called Pax Mongolica.

Explanation:

One example of a pattern of Mongolian expansion between the period c. 1200-c. 1450 was the establishment of trade route throughout different nations and regions. The Mongol Empire integrated its power in different parts of Eurasia and Asia by establishing a trade route called Pax Mongolica.

Mongol empire controlled almost all the countries that Silk route previously touched. This made the empire more powerful and helped in maintaining its sovereignity among these countries for a very long time.

ONE example of a pattern of Mongolian expansion in the period c. 1200-c. 1450 is:

Establishing a trade route called Pax Mongolica.

The Mongol Empire is considered one of the greatest empires in history, especially under the leadership of Genghis Khan as they conquered most of Asia due to their great warriors.

As a result of their great military might, they were able to invade and conquer a lot of territories.

One example of this Mongolian expansion during the period of 1200 and 1450 was the fact that they created a trade route which was called Pax Mongolica.

Therefore, the answer is establishing a trade route called Pax Mongolica.

Read more here:

https://brainly.com/question/18160272

Other Questions
PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important. PLEASE HELPPP1) Briefly describe the process of DNA replication. a) Start with the molecular machinery and be sure to describe what DNA polymerase does. Use the terms free nucleotides, helicase, polymerase, complementary.b) describe the result; how many strands were made? Describe their composition. Use the terms parental DNA and new DNA.