The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first

Answers

Answer 1

Answer:

Follows are the solution to this question:

Explanation:

The creation of four fragments,  

(n endpoint) MNQSYGR (c endpoint)  

Weight of the molecular = 854.92

Load = 2

[tex]\to \frac{mass}{Load}[/tex] = 427.46

(n endpoint)RLVSR (c endpoint)

Weight of the molecular = 629.76

Load = 3

[tex]\to \frac{mass}{Load}[/tex]= 209.92

(n endpoint) AATAMASLIK (c endpoint)

Weight of the molecular = 976.20

Load at pH(2). = 2

[tex]\to \frac{mass}{Load}[/tex]= 442.50

(n endpoint) IFAWWY (c endpoint)

Weight of the molecular = 885.03

Load= 1

[tex]\to \frac{mass}{Load}[/tex]= 885.03

It is apparent that RLVSR is the smallest mass ration for this peptide that is detected in the first place.


Related Questions

Without SALT or SUGAR, does the water conduct electricity?

Answers

No, because water has very few ions therefore it is a poor conductor

All sound begins with a vibration. Sound travels through the air to your ears which our brains interpret as sound. How are guitar strings like the particles in matter?
1.They are gold
2.They vibrate
3.They are a liquid
Pick One.

Answers

answer is: 2. they vibrate

(b) in the direct hydration method, ethene reacts with steam. The equation for this reaction is C2H4 + H2O = C2H5OH

State the temperature and pressure used in this reaction.

Answers

Answer:

20 degree and 4000000N

An unknown compound containing only C and H was burnt, yielding 10.2 g of CO2 and 6.3 g of H2O. With a molecular weight of about 30, what is the molecular formula?

Answers

Answer:

[tex]C_2H_6[/tex]

Explanation:

Hello.

In this case, we can see that the mass of carbon of the unknown compound comes from the yielded mass of carbon dioxide, thus, we compute the moles of carbon as follows:

[tex]m_C=10.2gCO_2*\frac{1molCO_2}{44gCO_2}*\frac{1mol C}{1molCO_2}=0.232 molC[/tex]

Moreover, the mass of hydrogen comes from the yielded water, therefore we can also compute the moles of water:

[tex]m_H=6.3gH_2O*\frac{1molH_2O}{18gH_2O}*\frac{2molH_2}{1molH_2O} =0.7molH[/tex]

Then, to find the subscripts in the empirical formula, we divide by the moles of carbon as the smallest:

[tex]C:\frac{0.232}{0.232}=1\\ \\H:\frac{0.7}{0.232}=3[/tex]

Whose molar mass is:

[tex]M_{CH_3}=12+1*3=15g/mol[/tex]

Thus, the ratio of the molecular formula to the empirical formula is:

[tex]\frac{30}{15}=2[/tex]

Therefore, the molecular formula is twice the empirical formula:

[tex]C_2H_6[/tex]

Which is actually ethane.

Regards.

True or false, the nucleus is the core of an atom

Answers

Answer:true

Explanation:

The neutrons and the protons are what stay there

Which of the following statements is true?

A:Transverse waves move particles parallel to the direction of energy.
B:Longitudinal waves move particles at right angles to the direction of energy.
C:Transverse waves usually occur in solids, while longitudinal waves occur in liquids and gases.
D:All of the above.

Answers

Answer:B

Explanation:

I’d go with D bc usually all of the above is the answer

The net ionic equation for the reaction between aqueous nitric acid and aqueous sodium hydroxide is ________. The net ionic equation for the reaction between aqueous nitric acid and aqueous sodium hydroxide is ________. H+ (aq) + Na+ (aq) + OH- (aq) → H2O (l) + Na+ (aq) HNO3 (aq) + OH- (aq) → NO3- (aq) + H2O (l) H+ (aq) + HNO3 (aq) + 2OH- (aq) → 2H2O (l) + NO3- (aq) H+ (aq) + OH- (aq) → H2O (l) HNO3 (aq) + NaOH (aq) → NaNO3 (aq) + H2O (l)

Answers

Answer:

H+ (aq) + OH- (aq) → H2O (l)

Explanation:

The net ionic equation is the main reaction going on in the system. The reaction between nitric acid and sodium hydroxide is a neutralization reaction.

In a neutralization reaction, the main reaction is the combination of hydrogen ions and hydroxide ions to form water. This reaction has been shown in the answer box.

3. True or False. A compound is formed when two or more elements are
False
True

Answers

True a compound would be H20
umm true you can make anything with two elements

"the tamil naducoast recives winter rainfall "why?​

Answers

Answer:

GDSSHCVJDJD

Explanation:

How does a scientist make two solutions with the same molarity? A By dissolving the maximum amount of each substance in the B. By dissolving the same number of grams of each substance in the OC. By dissolving 1 mole of each substance in enough water to make same volume of water same volume of water sure dissolving is complete By dissolving the same number of nmoles of each substance in the same volume of water OD.​

Answers

Answer: The answer is “ By dissolving the same number of nmoles of each substance in the same volume of water ”

Explanation:

By dissolving the same number of moles of each substance in the same volume of water. Hence, option D is correct.

Define the molarity of a solution.

Molarity (M) is the amount of a substance in a certain volume of solution. Molarity is defined as the moles of a solute per litres of a solution.

Adding water to a solution and the number of moles of the solvent stay the same while the volume increases.

If there is no flow of solute into or out of the volume during the addition of the solvent, the number of moles of solute remains the same.

Hence, option D is correct.

Learn more about moles here:

brainly.com/question/8455949

#SPJ2

What is the frequency of a photon with an energy

Answers

Answer:

option b is correct option = (6.76×10¹⁴ Hz)

Explanation:

Given data:

Wavelength of photon = 4.42×10⁻⁷ m

Speed of light = 2.99×10⁸ m/s

Frequency of radiation = ?

Solution:

Formula:

Speed of wave = frequency × wavelength

Now we will rearrange this formula.

frequency  = Speed of wave / wavelength

f = c/ λ

f =  2.99×10⁸ m/s / 4.42×10⁻⁷ m

f = 0.676×10¹⁵ Hz   (s⁻¹ = Hz)

f = 6.76×10¹⁴ Hz

Thus option b is correct option.


Soil is an essential component of the earth's crust. It enabled life to exist and
provides the services necessary for human survival. What is the effect of soil
erosion? What will you do to protect the community?​

Answers

Answer:

The consequences of soil erosion go beyond the loss of fertile land. It has contributed to increased runoff and sedimentation in streams and rivers, clogging these waters and causing declines in fish and other animals.

We can protect the community from soil erosion by -:

Maintaining a good, perennial cover for plants.  From mulching.  Planting a crop for cover

Explanation:

SOIL EROSION -: The soil erosion mechanism is both natural and man-made. In nature, this refers to the removal of the top layer of soil caused by wind and water, while human activity may increase exposure to these elements.

MAJOR EFFECTS OF SOIL EROSION -:

Pollution and Low Water Quality -: Sedimentation is created by gradual soil erosion, a process by which rocks and minerals in the soil are separated from the soil and deposited elsewhere, often in streams and rivers. Soil contaminants, such as fertilizers and pest control agents, often settle in the streams and rivers to protect crops. Water contaminants contribute to low water quality, including drinking water quality, if the contaminants are not removed prior to ingestion. As sunlight can get through the sediment, sedimentation also leads to the excessive growth of algae. According to the World Wildlife Fund, high levels of algae drain too much oxygen from the water, resulting in the mortality of marine species and reduced fish stocks.Structural Issues and Mudslides -: Soil erosion contributes to mudslides, impacting the stability of buildings and roadways and their structural integrity. Mudslides affect not only soil-supported structures, but also buildings and roads that are in the path of slides. Mudslides occur when, as a result of the intensity and energy of heavy rainfall, fine sand , clay, silt, organic matter and soil spill off the sides of hills and slopes. According to Envirothon, a program of the National Conservation Foundation and North America's largest high school environmental education competition, this runoff happens rapidly, because there is not enough time for the surface to reabsorb or catch the eroding soil.Flooding and Deforestation -: Deforestation erodes soil — the removal of trees to create space for towns and agriculture. Trees help to maintain soil in place, so winds and rains drive the loose soil and rocks to streams and rivers when they are uprooted, resulting again in unnecessary sedimentation. The thick layers of sediment keep streams and rivers from flowing smoothly, ultimately contributing to flooding. Excess water, especially during rainy seasons and when the snow melts, gets trapped by the sediment and has nowhere to go except back on land.The Deterioration of Soil -: Soil nutrient depletion is often the result of poorly performed cultivation and cultivation practices that contribute to soil erosion. For natural vegetation and agricultural purposes, excessive irrigation and obsolete tilling practices decrease the amount of nutrients in the soil and make it less fertile.

PROTECTION OF COMMUNITY FROM SOIL EROSION -

Maintaining a good, perennial cover for plants  -: Your perennial garden's care and upkeep need not be difficult or overwhelming. A blend of certain simple horticultural values with common sense and a good eye is a great part of good gardening.MULCHING -: The amount of water that evaporates from your soil will be reduced by mulch, greatly reducing the need to water the plants. By breaking up clay and permitting better movement of water and air through the soil. Mulch supplements sandy soil with nutrients and enhances its ability to retain water. PLANTING A  CROP FOR COVER -: Winter rye in vegetable gardens, for instance. This includes annual grasses, small grains , legumes and other forms of vegetation that have been planted to provide temporary vegetative cover. Cover crops are also often tilled as a 'green manure' crop under serving.

Some of the effects of erosion on the environment includes :

Washing away of soil nutrients Pollution of the waterways Blockage of drainages degradation of soil

Ways to protect the earth from soil erosion includes

planting of cover crops Mulching use of crush rocks on certain areas

Soli erosion is the washing away of the top soil of the earth's crust which can be caused by the movement of wind , water or ice over the surface of the earth crust. this action leads to the degradation of the soil

Soli erosion leads to the washing away of soil nutrients and the pollution of waterways because of the deposition of soil particles into the waterways.  the washed away soil can also block the drainages leading to a bigger problem ( flooding ).

Some of the steps that would help protect the soil from the effects of soil erosion are planting of cover crops , mulching and use of crush rocks on areas that are used most frequently to prevent the washing away of the soil.

Hence we can conclude that the effects of soil erosion are Washing away of soil nutrients , Pollution of the waterways, Blockage of drainages while ways to protect the earth from erosion are ;planting of cover crops, Mulching, use of crush rocks on certain areas

Learn more : https://brainly.com/question/24104585

I NEED HELPPP THIS DUE TODAY!!!! IT IS URGENT!!

Answers

1. The graph represents that is a positive line .
2. Every time you’re going up it increases by 1.4

You have 100. grams of potassium fluoride (KF). How many moles do you have? (1 mole KF = 58.09 g KF) *

1.00 mole KF

1.50 mole KF

1.72 mole KF

3.57 mole KF

Answers

Answer:

I think its 1.72 (:

Explanation:

What is the organism that kills and eats other organisms for food called?

Group of answer choices

Host

Parasite

Predator

Prey

Answers

It’s predator ie: lions tigers etc
The answer would be a predator

help pls 100 points and brainiest

Answers

Answer:

The amount of salt solution.

Explanation:

so first you have to think about it as a y = mx + b function, where m and x are constants. So basically the independent variable is represented by the amount of salt solution because the health of the patient is affected by the amount of salt solution. this is how you would write it out as an equation so you can understand it better.

The Health of the patient   = The amount of salt solution + b

Since y depends on the values of m, x, and b, The amount of salt solution would be the independent variable.

In a chemistry laboratory, a student filled a 10.0 L container with two (2) different gases. The
gases are nitrogen gas taken from 24.0 L container at 2.00 atm and 12.0 L container of
oxygen at 2.00 atm. If the temperature of the gases is 273 K, calculate the partial pressure
of both gases in the resulting mixture and the total pressure.​

Answers

Answer:

[tex]P_N=1.33atm\\\\P_O=0.67atm[/tex]

[tex]P_T=2.00 atm[/tex]

Explanation:

Hello.

In this case, the first step is to compute the moles of nitrogen and oxygen given their initial P, T and V conditions via the ideal gas equation:

[tex]n_{N}=\frac{P_{N}V_{N}}{RT} =\frac{2.00atm*24.0L}{0.082\frac{atm*L}{mol*K}*273K}\\ \\n_{N}=2.144molN\\\\n_{O}=\frac{P_{O}V_{O}}{RT} =\frac{2.00atm*12.0L}{0.082\frac{atm*L}{mol*K}*273K}\\ \\n_{O}=1.072molO[/tex]

After that, since the total volume now, once the mixture is formed is the addition between the initial volumes (12.0 L + 24.0 L) is 36.0 L, the partial pressure of each gas turns out:

[tex]P_N=\frac{2.144mol*0.082\frac{atm*L}{mol*K}*273K}{36.0L}\\\\P_N=1.33atm\\\\P_O=\frac{1.072mol*0.082\frac{atm*L}{mol*K}*273K}{36.0L}\\\\P_O=0.67atm[/tex]

Thus, the final total pressure is:

[tex]P_T= P_N+P_O=1.33atm+0.67atm\\\\P_T=2.00 atm[/tex]

Best regards.

Why does a water molecule have a bent shape?

Answers

The 2 lone electron pairs exerts a little extra repulsion on the two bonding hydrogen atoms to create a slight compression to a 104obond angle. The water molecule is bent molecular geometry because the lone electron pairs, although still exerting influence on the shape, are invisible when looking at molecular geometry.

Answer:

The oxygen atom has lone pairs of electrons.

Explanation:

Consider the reaction and indicate which reactant is the Lewis acid and which is the Lewis base. C H 3 C O Cl and F e C L 3 give F e C L 4 minus and C H 3 C O plus. The structure of C H 3 C O C L is a central carbon double bonded to an oxygen containing two lone pairs. The central carbon is also bonded to a methyl group and a chlorine, which contains three lone pairs. The product is a central carbon with a plus charge, which is double bonded to an oxygen which contains two lone pairs. THe carbocation is also bonded to a methyl group. Identify the true statement(s).

Answers

Answer:

[tex]\mathbf{FeCl_3}[/tex] is the lewis acid

[tex]\mathbf{CH_3COCl}[/tex] is the lewis base

Explanation:

The Lewis acid is a compound capable of accepting a doublet of electrons and which has an electronic gap on its valence layer.

The lewis base is a compound capable of donating a doublet of electrons.

A Lewis acid associates with a Lewis base through a covalent bond (sharing of two electrons between two atoms). The reaction between an acid and a Lewis base produces a compound called the Lewis adduct.

We can see the illustration of the diagrammatic expression in the image attached below.

Read The Pros and Cons of Plastic to explore some of the useful properties of plastics.

Which properties of plastics allow them to be solutions to many complex problems in the world? Check all that apply.

chemically resistant
durable
non-reactive
high weight
easy to manufacture

Answers

Answer:

chemically resistant

durable

non-reactive

easy to manufacture

Explanation:

Plastics are polymer materials which can be moulded or shaped into any desired shape when hot. There are two types of plastics; thermoplastics and thermo sets.

Most plastics are easily manufactured. They are light weight materials , chemically stable, durable and do not undergo chemical reactions upon prolonged exposure to the atmosphere.

The study of chemicals is called chemistry.

The correct answer is options B, C, and E

The plastic is made by the carbon by joining with itself by a covalent bond and this property of carbon is known as catenation.

In today's time plastic is used all over the world and it is because of the following reasons.

Plastic is durable and long lastPlastic is nonreactive and it does not react to anything and remain stable in the free state.Plastic is easy to manufacture because of the high availability of carbon.

Hence, the correct answer is B, C, and E.

For more information, refer to the link:-

https://brainly.com/question/25305623

40.00 grams of NaOH is added into distilled water and diluted with water to 1000mL of final volume. What is the final concentration of the NaOH

Answers

Answer:

The molar mass of NaOH is 40.00 g/mol.

The number of moles of NaOH is equal to the ratio of its mass to molar mass.

The number of moles of NaOH =

40 g/mol

40 g

=1,000 mol

The molarity of NaOH solution is the ratio of number of moles of NaOH to total volume of solution in L.

M=

1 L

1 mol

=1 M

Explanation ;)

Viktor tests a solution with a strip of blue litmus paper. The paper turns pink. The solution is a _____.
weak acid
weak base
strong acid
strong base

Answers

Answer:

The solution is acidic.

Explanation:

The answer is: Strong base.


Have a good day!

. Give two everyday examples of the thermal energy of a substance being increased.

Answers

Answer:

• the warmth from the sun

• the heat from another a heater

• A cup of hot chocolate

•baking in an oven

Two everyday example that we say for the thermal energy of a substance being increased are, faster movement of the substances and boiling if liquids as well light absorption.

What is thermal energy?

Thermal energy is a form of energy generated by heating up a substance. It can also be generated by the movement of its particles.

Vibrating molecules increases the thermal energy of a substance. Similarly, when we heat a substance it acquires more thermal energy.

Another way of increasing thermal energy is light absorption by the substance. Thermal energy associated with light increases the temperature of of the system which is absorbed the light.

Hence, the two ways by which thermal energy of a substance is increased are heating or boiling and faster movement.

To learn more about thermal energy, refer the link below:

https://brainly.com/question/3022807

#SPJ2

What do you notice about the relationship between the force strength and the size of the velocity change? HELP MEEEEE

Answers

Velocity change increases as the force increases.

Even though this question is incomplete, but we can approach it from the stand point of Newton's second law of motion.

According to this law, force is directly proportional to change in velocity.

F = m(v - u)/t

F = force applied

m = mass of the body

v = final velocity of the body

u = initial velocity of the body

t = time taken

This means that velocity change increases as force increases.

Learn more:  https://brainly.com/question/19860811

The greater the amount of mass an object has, the more force is needed to move it.

Answers

Answer: Newtons Second Law states that acceleration is produced when a force acts on a mass. The greater the mass (of the object being accelerated), the greater the amount of force needed to accelerate the object (bullet in our case). Everyone inherently knows that heavier objects require more force to move the same distance as lighter objects.

Explanation:

Which of the following terms best reflects the process by which humans store memories ?

Answers

Answer:

there are no term

Explanation:

what are the term

Do all variations help organisms survive

Answers

Answer:

Yes

Explanation:

Or maybe i dont really know what it mean

Why is digestion an example of both physical and chemical change simultaneously​

Answers

Answer: Here is why,

Explanation: Burning of wood is a example of both physical and chemical change. ... Another example is digestion of food ,first the food is chewed into small pieces this is a chemical change while in the actual digestion process it is chemically broken with the help of digestive enzymes and saliva

1) Consider the dissolution of CaCO3 compound in aqueous medium.
a) Write down the equation of the chemical reaction that represents this dissolution.
b) Write the expression of the equilibrium constant for this reaction.
c) Explain how the addition of a certain amount of sodium carbonate to
water would affect this balance

2) The equilibrium constant for the reaction 2 SO2(g) + O2(g) 2 SO3(g) has a Kc value = 2.5x10^10 to 500 K. Find the kc value for each of the following reactions at the same temperature
(a) SO2(g) +1/2 O2 SO3(g).
(b) SO3(g) SO2(g)+1/2 O2(g)
(c) 3SO3(g)+ 3/2 O2(g) 3SO3(g)

3) A reaction mixture consisting of 0.400 mol H 2 and 1.60 mol I 2 was prepared in a 3.00 L flask and heated. In balance, 60.0% of the hydrogen gas reacted. What is the equilibrium constant for the reaction H 2(g) + I 2(g) 2 HI(g) at this temperature?

Answers

Explanation:

1a) CaCO₃(s) → Ca²⁺(aq) + CO₃²⁻(aq)

1b) Remember, solids are not included in the equilibrium equation.

K = [Ca²⁺] [CO₃²⁻]

1c) Adding CO₃²⁻ ions will shift the reaction to the left, producing CaCO₃(s) until equilibrium is restored.

2) 2 SO₂(g) + O₂(g) → 2 SO₃(g)

Kc = 2.5×10¹⁰ = [SO₃]² / ([SO₂]² [O₂])

2a) SO₂(g) + ½ O₂(g) → SO₃(g)

Kc = [SO₃] / ([SO₂] [O₂]^½)

Kc² = [SO₃]² / ([SO₂]² [O₂])

Kc² = 2.5×10¹⁰

Kc ≈ 1.58×10⁵

2b) SO₃(g) → SO₂(g) + ½ O₂(g)

Kc = [SO₂] [O₂]^½ / [SO₃]

Kc = 1 / (1.58×10⁵)

Kc ≈ 6.33×10⁻⁶

2c) 3 SO₂(g) + ³/₂ O₂(g) → 3 SO₃(g)

Kc = [SO₃]³ / ([SO₂]³ [O₂]^³/₂)

Kc = ([SO₃] / ([SO₂] [O₂]^½))³

Kc = (1.58×10⁵)³

Kc ≈ 3.95×10¹⁵

3) H₂(g) + I₂(g) → 2 HI(g)

K = [HI]² / ([H₂] [I₂])

Make an ICE table.

[tex]\left[\begin{array}{cccc}&Initial&Change&Equilibrium\\H_{2}&0.400&-0.240&0.160\\I_{2}&1.60&-0.240&1.360\\HI&0&+0.480&0.480\end{array}\right][/tex]

K = (0.480)² / (0.160 × 1.360)

K = 1.06

(a) At what substrate concentration would an enzyme with a kcat of 30.0 s−1 and a Km of 0.0050 M operate at one-quarter of its maximum rate? (b) Determine the fraction of Vmax that would be obtained at the following substrate concentrations [S]: ½Km, 2Km, and 10Km. (c) An enzyme that catalyzes the reaction X ⇌ Y is isolated from two bacterial species. The enzymes have the same Vmax but different Km values for the substrate X. Enzyme A has a Km of 2.0 μM, and enzyme B has a Km of 0.5 μM. The plot below shows the kinetics of reactions carried out with the same concentration of each enzyme and with [X] = 1 μM. Which curve corresponds to which enzyme?

Answers

The missing graph is in the attachment.

Answer: (a) [S] = 0.0016M

              (b) Vmax = 3V; Vmax = [tex]\frac{3V}{2}[/tex]; Vmax = [tex]\frac{11V}{10}[/tex]

              (c) Enzyme A: black graph; Enzyme B = red graph

Explanation: Enzyme is a protein-based molecule that speed up the rate of a reaction. Enzyme Kinetics studies the reaction rates of it.

The relationship between substrate and rate of reaction is determined by the Michaelis-Menten Equation:

[tex]V=\frac{V_{max}[S]}{K_{M}+[S]}[/tex]

in which:

V is initial velocity of reaction

Vmax is maximum rate of reaction when enzyme's active sites are saturated;

[S] is substrate concentration;

Km is measure of affinity between enzyme and its substrate;

(a) To determine concentration:

[tex]0.25V_{max}=\frac{V_{max}[S]}{0.005+[S]}[/tex]

[tex]0.25V_{max}(0.005+[S])=V_{max}[S][/tex]

[tex]0.00125+0.25[S]=[S][/tex]

0.75[S] = 0.00125

[S] = 0.0016M

For a Km of 0.005M, substrate's concentration is 0.0016M.

(b) Still using Michaelis-Menten:

[tex]V=\frac{V_{max}[S]}{K_{M}+[S]}[/tex]

Rearraging for Vmax:

[tex]V_{max}=\frac{V(K_{M}+[S])}{[S]}[/tex]

(b-I) for [S] = 1/2Km

[tex]V_{max}=\frac{V(K_{M}+0.5K_{M})}{0.5K_{M}}[/tex]

[tex]V_{max}=\frac{V(1.5K_{M})}{0.5K_{M}}[/tex]

[tex]V_{max}=[/tex] 3V

(b-II) for [S] = 2Km

[tex]V_{max}=\frac{V(K_{M}+2K_{M})}{2K_{M}}[/tex]

[tex]V_{max}=\frac{V(3K_M)}{2K_M}[/tex]

[tex]V_{max}=\frac{3V}{2}[/tex]

(b-III) for [S] = 10Km

[tex]V_{max}=\frac{V(K_{M}+10K_M)}{10K_M}[/tex]

[tex]V_{max}=\frac{V(11K_{M})}{10K_{M}}[/tex]

[tex]V_{max}=\frac{11V}{10}[/tex]

(c) Being the affinity between enzyme and substrate, the lower Km is the less substrate is needed to reach half of maximum velocity.

Km of enzyme A is 2μM and of enzyme B is 0.5μM.

Enzyme B has lower Km than enzyme A, which means the first will need a lower concnetration of substrate to reach half of Vmax.

Analyzing each plot, notice that the red-coloured graph reaches half at a lower concentration, therefore, red-coloured plot is for enzyme B, while black-coloured plot is for enzyme A

Other Questions
What did the Spanish government's land grants include that caused hardship for American Indians, and what hardship did it cause? PLEASE HELP, PLEASE! PLEASE HELP ME how do you solve a system of linear equations by graphing The carousel was invented when and by who? can someone help me identify the speaker. occasion. audience. purpose. and tone ? Source. Ye Chunji, county official during the Minz dyrasty, order issued tolimit wedding expenses, 1570's,The frugal men with only one bas of silver currency can have something leftover, whereas the extravagant man with a thousand can still not have enough How kids can save water? use matrices to determine the coordinates of the vertices of the translated figure. Triangle DEF with vertex matrix [7 -9 -1 -7 -3 -7] translated 1 unites left and 4 units down. Why is the Congress so responsive to the people A-Mind control B-Intrest group access C-Frequency of elections D-Elite theory 5 & 6 ? Explain please Dora saved $35. She earned $9.50 per hour at her job. How many hours must she work to have a total of $358 in her savings? I have to do step by step why the answer of (5x - 1) (5x - 1) is 25x^2 - 10x + 1.How do i do it? (5x - 1) (5x - 1) Ans: 25x^2 - 10x + 1 is this a sentence? I think we gave $50 to charity last year. A. yesB. no How does this information help the reader understand Master Grimsleys action in A Horse Tale? Select three options below Tracey is looking at two different travel agencies to plan her vacation. ABC Travel offers a plane ticket for $295 and a rental car for $39 per day. M & N Travel offers a plane ticket for $350 and a rental car for $33 per day. What is the minimum number of days that Shirleys vacation should be for M & N Travel to have the better deal? Which of the following terms best reflects the process by which humans store memories ? Which of the following statement is true?3 / 12 is the same as 3 123/12 is the same as 12 33 12 is the same as 12/312/3 is the same as 3/12 Drag each tile to the correct box.Match the following wars to the effects they produced. In The Scarlet Letter, what is the effect of Hesters decision to dress pearl in red clothing? help im stupid plzzzzz who were early farmers in new mexico