The Passage is Ocean Exploration

Why does the author think that the time may now be right to focus on ocean research? Group of answer choices
A) There is nothing more to be learned from space research.
B) Ocean research will cost less than the space program.
C) The space shuttle program has come to an end.
D) Space travel has no value here on earth.

FIRST TO ANSWER GETS BRAINLIEST

Answers

Answer 1

Answer:

C) The space shuttle program has come to an end.

Explanation:

A. is not the right answer. The author never suggests there is nothing more to be learned from researching space, as space is still wast unresearched segment.

B. is not the correct answer. The prices of the ocean and space programs are not compared.

C. is the right answer. The author says the space shuttle program has ended in July 2011. after three decades and an estimated price of $200 billion. With this ending came the question of what is the next big thing to research. Finally, it has been decided that the next research area will be the ocean.

D. is not the right answer. The author doesn’t say space research is useless to humans, as we have a lot to gain from knowing more about the universe.


Related Questions

I need a speech about something your passionate about.
It could be literally anything.
Or any ideas.

Answers

Answer: some ideas your room, your style/aesthetic, your hair, your relationships, some of your hobbies, your love for your god/gods, a book(s), making stories, a small business of yours, etc. the possibilities are endless

Hope this helps you out :D

Answer: I believe that people who stutter should not be made fun of. Stuttering — also called stammering or childhood-onset fluency disorder — is a speech disorder that involves frequent and significant problems with normal fluency and flow of speech. People who stutter know what they want to say, but have difficulty saying it.

They don't deserve to be laughed at. They deserve to be supported and helped. None of the kids with this disorder asked for it. They definitely didn't asked to be shoved around, picked on, made fun of, laughed at, and there is SO much more that people do just to be mean to them.

The kids who are mean deserve to be shown how it feels. Now I'm not saying that they need to me made fun of or have a disability. I'm saying that they need to sit down with someone, and learn what it means to have this disorder. For those of you who have ever picked on anybody, have you stopped to think about what they might be going through?

You can copy the speech if you want. Hope I helped. Please just say thanks by pressing the heart button.


1.which third-person point of view does
the narrator use? On the sidewalk in front of one of the stores sat a little
Swede boy, crying bitterly. He was about five years old. His black cloth
coat was too big for him and made him look like a little old man.*
O A. limited: Carl's point of view
B. limited: Emil's point of view
O C. limited: Alexander's point of view
O D. omniscient point of view

Answers

Answer:

D. I think, hope this help you

Explanation:

Seriously need help!! First correct and full answer gets brainliest
1.The car ran out of gas, and it stopped in the middle of the road. *

(A) simple sentence
(B) compound sentence
(C) complex sentence
2.Kristy and Sam are doing their homework.
(A) simple sentence
(B) compound sentence
(C)complex sentence
3.The girl went to the store, and she bought some chips. *

A.simple sentence
B.compound sentence
C.complex sentence
4.If you did not do your homework, you will have detention. *

A. simple sentence
B. compound sentence
C. complex sentence


Do not answer my question if you're not going to answer them all at once.

Answers

1.) B
2.) A
3.) B
4.) C
Hope this helps hun!

What are the purposes of the imagery in this excerpt?
SELECT 3 OPTIONS
to emphasize how dangerously packed the streets are
to indicate that the soothsayer will talk to Caesar
to show that the soothsayer will send the people home
to highlight the idea that Caesar suffers from illness
to suggest that Caesar will soon be put to death​

Answers

To show that the soothsayer will send the people home

Answer:

A, B, E

Explanation:

I got 100% on edge

What information supports the idea that food should not be left out overnight?

A) Canned foods must be cooked to a high temperature under pressure as part of the canning process.
B) Recently, a number of outbreaks have been traced to fresh fruits and vegetables that were processed under less than sanitary conditions.
C) A broiler chicken carcass can be exposed to the drippings and juices of many thousands of other birds that went through the same cold water tank after slaughter.
D) Given warm moist conditions and an ample supply of nutrients, one bacterium that reproduces by dividing itself every half hour can produce 17 million progeny in 12 hours.
E) Changing a baby's diaper while preparing food is a bad idea that can easily spread illness.

Answers

Answer:

Either C or D. I would go with C.

Explanation:

Answer:

D)

Explanation:

You don't want food to be left out over night because of the risk of the food becoming spiled or for bacteria to get a chance to reproduce rapidly and cause sicknesses.

can I have a brainliest?

Select the correct answer. What is an advantage of discussing a topic or complex task with a group? A. It makes you maintain a specific role throughout the discussion. B. It shows you how to follow group discussion instructions. C. It allows you to explore points of view that differ from your own. D. It gives you an opportunity to have a conversation with friends.

Answers

Answer:

the answer is c

Explanation:

Select Yes if the group of words in italics is a noun phrase
select no if the group of words in italics is not a noun phrase​

Answers

Answer:

Order by columns: yes, yes, yes no. Hope this helps :)

Explanation:

Based on your analysis of the film and the story, write a few sentences explaining whether Laurence Yep created a realistic setting. Support your answer with details from the film and story

Answers

Answer:

Laurence Yep created a very realistic setting in Dragonwings. He included many accurate details, like early cars, horse-drawn buggies, and crowded streets.

Explanation:

I did the assainment :D Hope it helps!!

Answer/Explanation:

Sample Response: Laurence Yep created a very realistic setting in Dragonwings. He included many accurate details, like early cars, horse-drawn buggies, and crowded streets.

hope this helps

(Help needed please) The narrator’s motivation for reading in class is...
A) escaping the wildness of the room
B) her desire to get good grades
C) respect for her teacher
D) escaping chorus because she hates music

Answers

A) escaping the wildness of the room

Read the excerpt from "My First Memory (of
Librarians)."
The implicit details in this excerpt show that the speaker
feels
The welcoming smile of my librarian
The anticipation in my heart
All those books-another world—just waiting
At my fingertips
excited to learn about new places and things.
confident that the librarian likes her more than others.
unhappy that she has to wait to read all the books,
upset that there are too many books to explore

Answer:excited to learn about new places and things

Answers

Answer:a,

Explanation:

Excited to learn about new places and things

Answer:

A

Explanation:

i did it on edge In 2020

PLEASE HELP ASAP question 16

Answers

Answer:

I believe its A

Explanation:

Hope this helps! Also sorry if its wrong. It just seemed like the best answer to me

A I think if not b I’m sorry!

Walking is not the most exciting form of exercise a person can take on for fitness. Yet
it is low impact and requires no fancy equipment. That makes walking a simple
activity for those new to exercise. Walking is less likely than other exercises to cause
injury to leg tendons and muscles. All it requires is a good pair of sneakers-no cables,
stylish outfits, or weights required. Of course, a person could increase the benefit of
a workout by adding weights or speed walking.
Explain whether the main idea is explicit or implicit in this paragraph. (5 points)
1)
It is explicit because it is directly stated in the paragraph.
2) It is explicit because it is not directly stated in the paragraph.
3) It is implicit because it is directly stated in the paragraph.
4) It is implicit because it is not directly stated in the paragraph,

Answers

Answer:

It is A/1.

Explanation: Explicit means the moral of the story is just given to you, implicit means you got to figure out the moral. Hopes this helps!

Answer:

1) It is explicit because it is directly stated in the paragraph.

Explanation:

Explicit Means directly stated

Implicit means the opposite

In the text you can see that the main idea is clearly pointed out.

What do the tone and perspective of these excerpts reveal about the narrators' attitudes toward being different? Select three options.

Being different from everyone around you can be hard.
Being different from everyone around you is a fact of life
Being different from everyone around you is fun and exciting
Being different from everyone around you is everyone's goal
Being different from everyone around you can cause separation​

Answers

Options: 1, 3 and 6 because the narrator 1 feels being different can be hard, narrator 3 thinks it can be fun and exciting, and narrator 6 feels it can cause separation

Answer:

1,3,5

Explanation: hope this helps!!

what is justice in to kill a mockingbird​

Answers

Answer:

Justice is an important theme in To Kill a Mockingbird, in which Scout confronts difficult truths about bias and racism within her community. She learns that while the courts can be a potential source of justice, there are also other ways of achieving justice outside the courtroom.

Explanation:

Answer:

in the end of the novel, after the trial has ended, Bob attacks Scout and Jem because they are Atticus' children.The theme of justice is shown in To Kill a Mockingbird through Boo Radley, threats to Atticus' family caused by racism, and Tom's quest for justice through his trial.

Explanation:

COPY THE FOLLOWING PARAGRAPH AND EDIT IT(CORRECT). ONLY RUN-ONS AND FRAGMENTS;

I had a frightening dream last night,I dreamed that I was walking high up on an old railroad trestle. It looked like the one I used to walk on recklessly. When I was 10 years old. At that height my palms were sweating, just as they did when I was a boy. I could see the ground out of the corner of my eye, I felt a sickening sensation. I realized there were rats below. Thousands and thousands of rats. They knew I was up on the trestle, they were laughing. Because they were sure they would get me. Their teeth glinted in the moonlite, their red eyes were like reflectors. That almost blinded my sight Sensing there was something even more hideous behind me. I kept moving forward. Then I realize I was coming to a gap in the trestle. There was no way I could go back I would have to step over the empty gap. I leap out in despair. Knowing I would never make it. And felt myself falling helplessly down to the swarm of rejoicing rats. I woke up bathed in sweat.Half expecting to fins a rat in my hand.

Answers

Answer:

I had a frightening dream last night. I dreamed that I was walking high up on an old railroad trestle, it looked like the one I used to walk on, recklessly, when I was 10 years old. At that height, my palms were sweating, just as they did when I was a boy. I could see the ground out of the corner of my eye. I felt a sickening sensation. I realised there were rats below; thousands and thousands of rats. They knew I was up on the trestle. They were laughing because they were sure they would get me. Their teeth glinted in the moonlight, and their red eyes were like reflectors that almost blinded my sight. Sensing there was something more hideous behind me, I kept moving forward. Then, I realized I was coming to a gap in the trestle; there was no way I was going back, I would have to step over the empty gap. I leapt out in despair, knowing I would never make it, and felt myself falling helplessly down to the swarm of rejoicing rats. I woke up bathed in a sweat, half expecting to find a rat in my hand.

Explanation:

I have only corrected the incorrect punctuation, but there may be some spelling errors and wrongly placed tense and vocabulary in the paragraph, still needing editing. I hope this was a help for you as I have always enjoyed the subject English in school.

Need answers fast!
1. he car ran out of gas, and it stopped in the middle of the road. *

(A) simple sentence
(B) compound sentence
(C) complex sentence
2.Kristy and Sam are doing their homework.
(A) simple sentence
(B) compound sentence
(C)complex sentence
3.The girl went to the store, and she bought some chips. *

A.simple sentence
B.compound sentence
C.complex sentence
4.If you did not do your homework, you will have detention. *

A. simple sentence
B. compound sentence
C. complex sentence


Do not answer my question if you're not going to answer them all at once.

Answers

Answer:

Ello Haikyuu here!

Explanation:

Im going to try my best,

1. i think is (C)

2. i think is (B)

3. i think is (A)

4. i think is (B)

hope this helps, bro!

According to The Riddle of the Rosetta Stone what detail helped scholars determine that the second Egyptian scription was a simpler form of Egyptian writing that had been created by "the people"? O The scholars had seen examples of it before written on rolls of papyrus, a writing material used by the Egyptians. O Since the scholars had already studied Egyptian languages, they recognized both the hieroglyphs and the demotic version. OThe Greek inscription, which had already been deciphered, explained how to translate each of the Egyptian passages. OSince only ancient Egyptians understood hieroglyphs, the scholars knew the second inscription had to be a simpler version of the first.​

Answers

Answer:

the first statement

In the first line of the poem, Ha says, “Wishes I keep to myself.” What can you infer about Ha’s character based on this phrase?

Answers

Answer:

he is secretive more like a shy person

Why does Allen use a very academic tone in his persuasion

Answers

Probably to sound smarter and to grab their attention so that they will keep listening

Question--->(That is the reality)

Answers

C



because it’s a adverb

Question 5 (1 point)
Choose the answer.
Which best describes the effect of winter on the story's plot?
There is little effect. The cat must still struggle to find food and shelter.
The cat's life becomes easier with the onset of winter.
Winter creates new conflicts that the cat must now face.
Winter indicates that a resolution is near since the family will be returning soon.

Answers

Answer:

Winter creates new conflicts that the cat must now face.

Explanation:

just took it and got is correct

Fragments: Look at the original word groups below. One of them may be a fragment. If it is, choose the answer from the options that corrects the fragment. If none of the word groups is a fragment, choose "The original word groups are all complete sentences." Pets can make good gifts for children. If the gift giver chooses the pet carefully.

Answers

Answer:

The answer that corrects the fragment is "Pets can make good gifts for children if the gift giver chooses the pet carefully."

Explanation:

Fragments are disconnected sentences from their main idea normally by the misuse of a period or comma, The original groups of words given are two separated sentences, by deleting the period between them we can have a full idea that follows the structure of fist conditional where we have the if clause that represents the condition or hypothetical situation, and the result that's the main clause. by making this change we will stop having fragments and we will have a correct first conditional sentence.

Help me plsss-
How does rereading information in a text help a reader monitor comprehension?

A. The reader can look up the definitions of difficult vocabulary words by reading additional references.

B. The reader scans the information in the text quickly to get a general idea of what the text is about.

C. The reader learns about the time period when the text was written by reading the author’s biography.

D. The reader gains a clear understanding of the details in the text before moving on to read more.

Answers

Answer:

D

Brainliest?

     

 

Answer:

D

Explanation:

The reader needs to gain a great and clear understanding before they continue which helps comprehension

What ethical issues does Thoreau have with his society

Answers

Answer:

INDIVIDUALISM. In "Civil Disobedience," Thoreau expressed his belief in the power and, indeed, the obligation of the individual to determine right from wrong, independent of the dictates of society: "any man more right than his neighbors, constitutes a majority of one" (Reform Papers, 74).

Explanation:

-from the web, hope it works :)

First, practice your speech on your own. Consider practicing your speech for friends or family members. After that you must present the speech to your teachers or class. Keep the following instructions in mind when preparing for the speech:

Be aware of the time limit of the presentation.
Know and understand the material that is being delivered.
Plan the delivery of every point in the speech.
Create notecards to help you remember the important information.
Also, consider the following practices when delivering a speech:

Speak naturally, clearly, and loudly enough that everyone can hear you.
Make eye contact with various people in the audience.
Use hand gestures when you need to emphasize a point.
Vary your tone and volume for emphasis.
Stand straight but comfortably.
Dress in a neat and presentable manner.
Before delivering your speech to your chosen audience, practice delivering the speech in front of a mirror or a smaller audience such as close friends or family members. Then, you will deliver the speech to your chosen audience. You can also use an audio recording tool, to record your speech and submit an audio version of your speech to your teacher, if your teacher agrees. However, this is not mandatory.

Answers

Answer:

speech making is not necessarily a tedious process.

Explanation:

Practising helps to strengthen your vocabulary, anf to identify mistakes that may have been made.

which transition is the best choice to start the bolded sentence Some people are born superstars really Michael Phelps the Olympic swimmer is a perfect example blank his hands and feet are bigger than normal which means which helps him move quickly through the water he can reach his arms high above and said than other swimmers A however be Bmorever V finally D equally important​

Answers

Answer:

i think that is correct

Explanation:

i know this does not help but i tried

To synthesize an idea, the information taken from two texts needs to be ____.
Different
None of these
Identical
Similar

Answers

Answer:

Similar

Explanation:


Which sentence describes the climax of the tale?
The husband encourages his wife to look at her reflection.
The husband returns from his journey with presents for his wife.
The mother tells her daughter to look in the mirror every morning
and evening
The mother decides to stop looking in the mirror and to appear
happy at all times.


Plz answer quick

Answers

The mother decides to stop looking in the mirror and appear happy at all times

why might concepts of necessity and uselessness be important?​

Answers

Answer:

Explanation:

What do these details show the characters and their lives? It is important because it shows how they live every day and that they have a lot of money and would rather just stay inside.

What prompted Father to give his sons a lesson about the dangers in life?

Answers

The boys see all animals as cuddly, not at all resembling the dangerous beasts that they are. In order to teach his sons about the dangerous natures of predatory animals, the father makes the boys watch a tiger devour a goat. Pi's response is “Life goes on and you don't touch tigers."
hope this helps!
would love brainliest if it did help :)
Other Questions
Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important. PLEASE HELPPP1) Briefly describe the process of DNA replication. a) Start with the molecular machinery and be sure to describe what DNA polymerase does. Use the terms free nucleotides, helicase, polymerase, complementary.b) describe the result; how many strands were made? Describe their composition. Use the terms parental DNA and new DNA. What was the impact of the petition of right? The model represents an equation. What value of x makes the equation true? I have no idea what these notes are can someone please help! These are violin notes. If you want to ensure that a particular application receives priority access to the network, you should configure what feature on the router? QoSDHCPUDPARP what does a literary critic help readers understand what is bigger 2/5 or 0.25 sam eats 1/4 of a pizza joe eats 1/2 of the remaining pizza. what part of the original pizza is left?