Based on the scenario below, select the statement that accurately finishes the sentence. Stacey has recently had
a car accident and has lost her sense of taste as a result. It is MOST likely that she has
A. damaged her peripheral nervous system because the information regarding taste cannot be
transmitted back to her brain
B. damaged her central nervous system because the tongue is so close to the brain
C. damaged her peripheral nervous system because this is typical for a spinal cord injury
D. damaged her peripheral nervous system because it is responsible for basic body functions like
breathing and taste

Answers

Answer 1

Answer:

correct

Explanation:

Answer 2

Answer:

A

Explanation:


Related Questions

2. Why are nutrients essential?

3. How can you practice good nutrition?

4. When should people become interested in wellness? Why?

5. What decisions are involved in practicing wellness?

6. Describe three ways that science impacts foods.

7. What might happen if you don't like the appearance or taste of the food you're eating?

8. In what ways is food socially significant?

9. Why do some foods actually make people feel more comfortable?

10. Compare the past and present significance of restaurants in people's lives?

11. How are cookbooks used today?

12. In what ways can food add adventure to life?

13. What shows the creativity of a chef?

14. What mistakes do many people make when getting ready to enter a career?

Answers

Answer:

2. Nutrients are essential because they help you move your body more fluent and are great for helping your cells get stronger so you can fight off viruses.

3. You can practice good nutrition by eating good foods that are healthy of good for you.

4. They should be interested in wellness when they don't feel to good they should want to be interested in their wellness to help their health.

5. Decisions that can be involved in practicing wellness is the way you do certain things like how much to you and what you eating can be changed.

Sorry the rest the answers I could not provide

Have a good day and hope you are able to get the rest

A serve that can be retaken in badminton is called?​

Answers

Answer:

Explanation:

A serve that strikes the net and lands in the opponent's court is a let serve and is retaken.  During service, players must stand in their respective service courts.  The receiving player is not permitted to move his/her feet until the badminton shuttlecock has been struck.

Following the dietary guidelines can help prevent chronic disease?
1.True
2.False

Answers

Answer:

True

Explanation:

I googled it

HOPE THIS HELPS

A patient is at risk of developing diabetes, so the doctor wants a measure of the patient’s blood sugar after several hours of not eating. How is this abbreviated on the patient’s chart?

hgb

FBS

EEG

BP

Answers

Answer:

(bgm) quite frankly i am a gyno med school last year and mothers have some of the same problems.

Explanation:

Blood glucose monitoring (BGM) fulfills four roles: (1) it provides data to the person with diabetes that can be used to self-adjust medication; (2) it provides averages that give the person with diabetes rough information about how well they are doing (both for avoiding hypoglycemia and in terms of blood glucose.

Answer:

B. FBS

Explanation:

Name 3 things that can happen to your body as a result of sleep deprivation?

Answers

Answer:

Explanation:

Sleep deprivation, also known as insufficient sleep or sleeplessness, is the condition of not having enough sleep. It can be either chronic or acute and may vary widely in severity. A chronic sleep-restricted state adversely affects the brain and cognitive function.

Effects

a. Stroke

b. Heart attack.

c. High blood pressure.

Answer:

Sleepiness Causes Accidents...

Sleep Loss Dumbs You Down...

Sleep Deprivation Can Lead to Serious Health Problems...

Lack of Sleep Kills Sex Drive...

Sleepiness Is Depressing...

Lack of Sleep Ages Your Skin...

Sleepiness Makes You Forgetful...

Losing Sleep Can Make You Gain Weight...

Hope I helped! Please mark me brainliest if I did.. Thanks!!

A person should get ________ if feelings of grief interfere with his or her life.

Answers

Answer:

anti-anxiety medication

Explanation:

I don't know if it has to be a certain answer but that is

what I know when it comes to that. You can also go to grief counseling.

anxiety medication

:)))))))))))))

Prompt:
Rosa eats a peanut butter sandwich for lunch. Peanut butter contains a lot of protein, and bread is mostly starch. Rosa plans to go for a run later this afternoon. Rosa is breathing normally.

(answer all parts) Questions:
What does she need from the food she ate and the air she breathes so that she can go on her run?
How do Rosa’s body systems work together to get the molecules she needs into her cells?
How do her cells use these molecules to release energy for her body to run?

Answers

Answer:jkjbkj

Questions:

What does she need from the food she ate and the air she breathes so that she can go on her run? eating enough food, because cells need molecules from both food and air to work

How do Rosa’s body systems work together to get the molecules she needs into her cells? These body systems all function to maintain the cells in your body: the circulatory, respiratory, and digestive systems provide the nutrients and energy your cells need to live.

How do her cells use these molecules to release energy for her body to run?Chemical energy is stored in the bonds of sugars. When a sugar molecule is broken down, a usable form of energy is released for the cell's life functions. Cells can release energy in two basic processes: cellular respiration and fermentation. ... In cells use oxygen to release energy stored in sugars such as glucose.

What are symptoms of anxiety?

What are symptoms of ptsd?

What are symptoms of mixed personalitys?

Answers

Anxiety: restlessness, irritability, excessive worry, racing thoughts, unwanted thoughts, trembling and more.

Ptsd: agitation, irritability, hostility, emotional detachment, unwanted thoughts, and more.

Mixed personality, borderline personality disorder: sucidual thoughts, inappropriate angry, intence and highly unstable mood swings, distorted self imagine, extreme reactions to real or perceived abandonment, and more.

Please seek help if you are not feeling good. I hope you are okay, and stay safe I know how you feel.

Positive, short-term, motivating, and inspiring stress is called __________. A. distress B. eustress C. adrenaline D. stressor

Answers

The correct answer is B !!

Answer: B. eustress

Explanation:

A very important rule to follow when working with experimental subjects is (blank) .
a) do no harm
b) don't forget to tape record everything
c) get there early
d) use animals instead of humans whenever possible

Answers

Answer:

(a)do no harm cause when using people gor experiments you are to care for them not distroy them

A short-term goal is a goal you want to accomplish in the near future, and a long-term goal requires more time to achieve.

Answers

Answer:

True

Explanation:

I don't know what you mean by this question, but it is true.

Hope this helps!

WHAT IS A RAPID HEART RATE CALLED?

Answers

Answer: Im not really sure

Explanation:

Tachycardia refers to a heart rate that's too fast. How that's defined may depend on your age and physical condition. Generally speaking, for adults, a heart rate of more than 100 beats per minute (BPM) is considered too fast.

Concepts allow someone to organize information and avoid relearning. Please select the best answer from the choices provided T F

Answers

Answer:

true

Explanation:

Answer: True

Explanation: edge2023

who knows yandere sim

Answers

me its the game right?

Answer:

Yandere sim is the creator of yandere simulator

Explanation:

ribosomes are the site of?

Answers

Answer:

Protein synthesis

Explanation:

It uses the genetic code from RNA to form amino acid chains and eventually make complex proteins!

What roles do the following nutrients play in the body? a. Carbohydrates b. fats c. Proteins

Answers

carbohydrates help fuel your brain, kidneys, heart muscles, and central nervous system.

fats give your body energy and to support cell growth. They also help protect your organs and help keep your body warm.

proteins are required for the structure, function, and regulation of the body's tissues and organs.

In contrast to a six month old, most
month old babies can sit upright.

Answers

Answer:

8

Explanation:

2. How does courteous behavior contribute to employability?

Answers

Answer:

Courtesy as well as courteous behavior contribute, because they leave an impact on those who view you. You can also think of it as "You never get a second chance at making a great first impression."

Because you are leaving the impression of how civilized and courteous you are they will possibly think highly of you, giving you a better opportunity than ones that acts irrational and out of stubbornness.

Think about it this way:

If you act courteous and mindful to those around you, you will have a better chance than one that acts irrational, because the person who is irrational will act out in spite and will act wild and will rebel to whatever it may be. This will leave a negative impact on their employability. This as well will not only make them lose the chance to be where you possibly are going to be employed at but, also other places as they could hear of their behavior and how they acted.

Courteous behavior contributes to employability, as courteousness and polite behavior are important because they have a positive impact on how others see you.

What is courteous behavior?

Courteous behavior is acting and behaving in a nice, respectful, and courteous manner toward others. Always act with the utmost politeness.

They may think highly of you because you are giving off the appearance that you are polite and civilized, which will give you a greater chance than someone who acts irrationally or out of stubbornness.

Their employability will be negatively impacted by this. This will also cause them to lose the opportunity to work where you might be hired, as well as other places if word gets out about their actions and behavior.

Thus, it is essential to have courteous behavior that contributes to employability.

To learn more about courteous behavior, refer to the link:

https://brainly.com/question/14689965

#SPJ2

which scenario is not shown in advertisement about alcohol

Answers

A lot actually... the abuse from it, the car crashes that happens, the fact it give you blackouts, and how it’s can and is an emotional outlet.

Michele has shopped for food article for the week. Help her place these different food articles in the best places in a refrigerator.

Answers

Answer: Door - condiments

lower shelf - meats and eggs

Upper shelf - leftovers

Crisper drawer - fruits and vegetables

Explanation:

Answer: door: condiments

Lower shelf: meats and eggs

Upper shelf: leftovers

Crisper drawer: fruits and vegetables

Explanation:

Plato

If u answer this u will be marked as brainliest.
What’s the weirdest smell you have ever smelled?

Answers

Gasoline or cigarettes

Dietary guidelines can help guide state and national health promotion initiatives?
1.True
2.False

Answers

Answer:

true

Explanation:

Which behavioral psychologist emphasized that scientific psychology should study observable behaviors rather than thoughts? (Hint: He studied the effects of rewards and punishment on mice.)
a) William James
b) Carl Rogers
c) Charles Darwin
d) B.F. Skinner

Answers

Answer:

B.F Skinner (D)

Explanation:

I just took the test and am surprised we have the same question.

B.F. Skinner emphasized that scientific psychology should study observable behaviors rather than thoughts. Therefore, option D is correct.

Who was B.F Skinner ?

The most significant psychologist of the 20th century, B.F. Skinner founded the field of behaviorism. Creator of the Skinner Box, he realized the importance of praise in learning and created the first psychological studies with measurable, reproducible outcomes.

B.F. Skinner's theory is predicated on the notion that learning is a result of altering overt behavior. Behavior modifications are the result of a person's reaction to environmental events (stimuli).

B.F. Skinner emphasized that scientific psychology should study observable behaviors rather than thoughts. Therefore, option D is correct.

Learn more about B.F Skinner, here:

https://brainly.com/question/8156147

#SPJ2

One physical bebefit of stretching is

Answers

Answer:

FLEXIBILITY

Explanation:

because most physical

Complete the following sentence.
There are two types of vitamins, fat-soluble and
-soluble.

Answers

Answer:

fat soluble and water soluble

Explanation:

two types of vitamins

Fat-soluble vitamins exist stored in the body's liver, fatty tissue, and muscles. The four fat-soluble vitamins exist vitamins A, D, E, and K.

Water-soluble vitamins exist not stored in the body. The nine water-soluble vitamins exist as vitamin C and all the B vitamins.

How many types of vitamins are there?

There exist two kinds of vitamins, fat-soluble and Water soluble.

The distinction between water-soluble and fat-soluble vitamins exists that water-soluble vitamins exist dissolved in water and fat-soluble vitamins exists dissolved in fat globules or lipids.

Fat-soluble vitamins exist stored in the body's liver, fatty tissue, and muscles. The four fat-soluble vitamins exist vitamins A, D, E, and K.

Water-soluble vitamins exist not stored in the body. The nine water-soluble vitamins exist as vitamin C and all the B vitamins.

To learn more about fat-soluble and Water soluble refer to:

https://brainly.com/question/773204

#SPJ2

What is an advantage of using a hormonal implant?

It is easily inserted in the vagina.
It is a 100 percent effective method of birth control.
It reduces the likelihood of contracting an STD.
It can prevent pregnancy for as long as four years.

Answers

Answer:

It can prevent pregnacy for as long as four years

Explanation:

got it right on edge 2020-2021

An advantage of using a hormonal implant is that it can prevent pregnancy for as long as four years.

What does hormonal implantation do?

Hormonal implantation is done on the upper arm, which is placed under the skin of the upper arm. lt releases a low and steady dose of progestational hormone in the uterus.

Typically the implantation suppresses the ovulation and can control the pregnancy.

Contraceptive implants are radio-opaque and can be seen on X-rays — helpful for determining the site of implantation.

Thus, an advantage of using a hormonal implant is that it can prevent pregnancy for as long as four years.

To learn more about the Contraceptive implants click here:

https://brainly.com/question/1457908

Which two teenagers are most likely to abstain from entering a sexual relationship?

Carter follows a religion that does not approve of sexual relationships before marriage.
Kai has friends who are almost all in sexual relationships.
John watches sitcoms that reinforce sexual relationships.
Nikki is from a culture where sex before marriage is considered immoral.
Chris has an older brother who has multiple sexual partners.

Answers

Answer:

Nikki

Explanation:

That’s a tough question to answer, because one person may follow their religion’s rules and some may not, but that would be the most logical answer.

Answer: Nikki is from a culture where sex before marriage is considered immoral.

Explanation:

What are 3-5 reasons why people would choose to be a)vegan, b) vegetarian, c) eat local food only?

Answers

they want to help stop animal cruelty/killing animals, they want to improve their diet and get more protein, meat or dairy products are gross, want to help the economy, to be cool

What are some advantages and disadvantages of sensory adaptation?

Answers

Answer:

Sensory evaluation makes use of the remarkable virtuosity and range of the human senses as a multi‐purpose instrument for measuring the sensory characteristics of foods. The brain protects itself from an overload of information from the senses by two processes: feature extraction and adaptation. The former involves information reduction by the extraction of selected features from the environment; these form the basis for the reconstruction of the percept in consciousness. The latter, adaptation, involves the attenuation of repetitive and constant input so as not to overload the brain with redundant information.

The effects of adaptation can be observed for all senses. For the chemical senses, the effect is that a constant odor or taste stimulus will be perceived as decreasing in intensity while sensitivity to that stimulus is also decreased. For sensory evaluation, this poses problems. It means that a taste or odor has a tendency to vanish while it is being observed and that sensitivity to subsequent stimuli will be altered. Such sensitivity drift in the human instrument must be anticipated in the design of measurement procedures for the sensory evaluation of food.

Explanation:

Answer: You cannot feel as much so that can be a problem if you get injured but it does help you better understand your surroundings

Explanation: Sensory adaptation refers to a reduction in sensitivity to a stimulus after constant exposure to it. While sensory adaptation reduces our awareness of a constant stimulus, it helps free up our attention and resources to attend to other stimuli in the environment around us.

What is the main difference between cardio and strength-training activities?

A.
Cardio activities increase your physical strength, while strength-training activities work your heart and lungs.
B.
Cardio activities work your heart and lungs, while strength-training activities strengthen your muscles.
C.
Cardio activities require short bursts of energy, while strength-training activities strengthen your body over long durations.
D.
Cardio activities improve your joints' range of motion, while strength-training activities work your heart and lungs.

Answers

Answer: (b)
Explanation:

Answer:

B. Cardio activities work your heart and lungs, while strength-training activities strengthen your muscles.

Explanation:

Other Questions
Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important. PLEASE HELPPP1) Briefly describe the process of DNA replication. a) Start with the molecular machinery and be sure to describe what DNA polymerase does. Use the terms free nucleotides, helicase, polymerase, complementary.b) describe the result; how many strands were made? Describe their composition. Use the terms parental DNA and new DNA. What was the impact of the petition of right?