ASAP
look in the picture

ASAPlook In The Picture

Answers

Answer 1

Answer:

Whats the story line?

Explanation:


Related Questions

-What is Patel asking the freshman
class at George Washington
University to do?

Answers

Answer:

What Patel is asking the freshman at George Washington University is to always be apart and be aware of what's going on and always take action.

Write a well-written paragraph answering the following question: What qualities do the Titanic passengers’ reactions have in common?

Answers

Answer:

Most people on the ship were all cold and scared. Other were Nonchalant, was no big deal, no panic, calm/ this is something we can fix, or some did panic a little.

Explanation:

sorry i could come up with any other ideas

Refer to Passage 1 to answer this question. How does the author feel about the "schemes" of others who have tried to address the problems caused by poor children in Ireland?
A.) He thinks these ideas are hilarious.
B.) He respects and admires these works.
C.) He believes these plans have many mistakes.
D.) He fears that these schemes place children in danger.

Answers

C he thinks they have many mistakes

Answer:

C

Explanation:

just took the test

what’s historical irony

Answers

Answer:

Historical irony is when hindsight provides an ironic perspective on an action or stance made in the past. This type of irony is perfect for a character who ends up in a ironic situation they would never expect. As the name suggests, this could apply to real life as well as fiction.

Explanation:

In the beginning of "Where Is Here?," what does the stranger say that he would like to do?

A poke around
B Meet the children

C. take photographs of the house
D. make an offer to buy the house

Answers

Answer:

100% sure it could be b if not then im sorry hope this helps.

Explanation:

Who should the government “cherish” according to Thoreau

Answers

Answer:

n “Civil Disobedience” Thoreau not only calls for resistance to immoral and unjust government actions, he also criticizes the foundations of representative democracy — majority rule, voting, and representation

Explanation:

PLEASE HELP WILL GIVE BRAINLIAEST AND 15 POINTS AND EXPLAIN HOW U KNOW THE ANSWER IF U DONT MIND
Which historical document is an example of a secondary source?
A.)the original text of the Declaration of Independence
B.)Eleanor Roosevelt's letter resigning from the DAR
C.)the 1964 documentary Nine from Little Rock
D.)the National Archives explanation of Brown vs. Board of Education

Answers

Answer:

D

Explanation:

It is a secondary source because it is an explanation, which is based on an actual event.

The historical document which is an example of a secondary source is (D)The National Archives explanation of Brown vs. Board of Education.

What do you mean by a secondary source?

A secondary source is a source which gives details and information about the the primary source. here, the information gathered in primary source is selected, modified and arranged in a specific manner.

Out of the given options, Option D is a source which explains the original source it was taken from.

Therefore, The historical document which is an example of a secondary source is (D)The National Archives explanation of Brown vs. Board of Education.

Learn more about Secondary sources on https://brainly.com/question/896456

#SPJ2

Describe in detail a moment OR event that causes the character to change, grow, or develop:
(story is smith of wootton major)

Answers

Answer:

We cannot access this story, please attach it to the question next time.

How did the Lords Proprietors benefit from the proprietary system? Check all that apply.

They created a court system to maintain order.
They were promised protection by colonists.
They were able to farm on free land.
They collected taxes from the colonists.
They were able to oppose English law.

Answers

Answer:

Promised protection, free land,

Explanation:

Answer:

they were able to farm on free land

they were promised protection by colonists

A paragraph can give _____ about the topic.
A facts
B opinions
C both A and B
D neither A nor B

Answers

Answer:

Both A and B

Explanation:

Because a paragraph can give you facts in one side of the conversation and in the other it can give you opinions. Hope this helped! Let me know if you have any more questions!

C both A and B

es la respuesta

esperó que te sirva :-)

True or false

The landlady house made Billy uncomfortable when he looked through the window

Answers

Answer:

True :)

Explanation:

Answer:

True

Explanation:

The bed and breakfast sign gave him a weird feeling

How is the group of nomads along the train tracks able to exist, if the government is so opposed to reading and learning?

Answers

You’re correct! Because they were hiding it

Which is the best definition of analyze? O Making something clear by describing O A person, animal, alien, and etc. in a poem Detailed examination of the elements or structure of something ОО Applying human characteristics to non-human items/objects​

Answers

Answer: Detailed examination of the elements or the structure of something

Explanation:

Which of the following line pairs suggests that the speaker lives in a dangerous neighborhood?
A)Touch guys in a flight / all alone at night.
B)Kissy little girls / with their hair in curls.
C)Panthers in the park / strangers in the dark.
D)I've got a magic charm / that i keep up my sleeve.​
E)i can walk on the ocean floor / and never have to breathe.

Answers

C but im not so sure , best of luck <3❤️

PLEASE HELP ME(look at picture)

Answers

Answer:

B

Explanation:

What are the common motives of Bully

Answers

Answer:

here are some common motives

Explanation:

being builed themselveshome issues self confidence problemsjust enjoying other people hurt

Answer:Power:

Control:

Revenge:

Envy

Popularity:

Peer Pressure

Delusional Justification:

Quiet Permission:

Help, please!
I have to do a school presentation on comparing and contrasting a poem and a story's theme (which I chose as love because it seemed easier)
However, I'm struggling to find a story and poem to compare and contrast. Does anyone have any recommendations?

Answers

Answer:

do raven

Explanation:

Further, [White Fang] was more directly connected with the Wild than [the other dogs]; and he knew more of its secrets and stratagems. A favourite trick of his was to lose his trail in running water and then lie quietly in a near-by thicket while their baffled cries arose around him. Which best describes the force that motivates White Fang to run for the woods when chased?

Answers

The available options are:

A. an external force based on friendship

B. an external force based on setting

C. an internal force based on instinct

D. an internal force based on feelings

Answer:

B. an external force based on setting

Explanation:

From the excerpt, it can be concluded that White Fang understood the in and out of the wood setting compared to the other dogs. This is perfectly described as White Fang quickly moves between the running water and near-by thicket, while losing the trail of the chasing dogs. However it's an external force because this activity of White Fang running to the wood is caused by the chasing dogs.

Answer:

B

Explanation:

1. List three similarities between homes and agricultural structures.

Answers

Answer:Farm building, any of the structures used in farming operations, which may include buildings to house families and workers, as well as livestock, machinery, and cropstion:

Explana

The term Agriculture structure means a wall, And the roofed structure is used exclusively for agricultural purposes be there the production, harvesting, storage, raising, or drying of agricultural commodities and livestock, including aquatic organisms.

What is production?

Production is the process of mixing multiple inputs, both immaterial (such as plans or information) and material (such as metal, wood, glass, or polymers). In a perfect world, this output would be a product or service that is useful to people and has value.

The similarities between homes and the agricultural, Farm building, any of the structures used in farming operations, which may include buildings to house families and workers, as well as livestock, machinery, and cropstion:

Therefore, The similarities between homes and the agricultural, structure of the machinery and the workers are been included.

Learn more about production here:

https://brainly.com/question/14787713

#SPJ2

What makes poetry different than prose?

Answers

Answer:

The basic difference between prose and poetry is that we have sentences and paragraphs, whereas lines and stanzas can be found in a poetry. Further, there is regular writing in prose, but there is a unique style of writing a poetry.

Explanation:

Answer:

Poetry uses idioms and proverbs, while proses use sound devices and such

Explanation:

I got it rite lol

When I say "Boomer you say Boomer!" is able to transition between formal and informal language is called? A. Sooner B. culture C. Power

Answers

Answer:

I tbh think that its B. •.•

In a tragically brief but historically sweeping life as an actor, Boseman played men of public life and private pain. Before August 28, we didn't know he, too, was bearing such a burden. That has only magnified his accomplishment, bringing him closer to the great figures whose shoes he wore on film. He played men who advanced a people's progress, a trail he helped blaze himself. He played icons, and died one, too.

What conclusion is BEST supported by the paragraph above?

Answers

Answer:

A

Explanation:

Read the paragraph below.

When Tyrese dropped his crutches and limped to the starting block, the audience froze. Then the starter’s signal sounded, and the swimmers dove in. An awkward splash emerged from lane eight, but Tyrese began reaching and kicking in earnest, keeping pace with many of his opponents. All eyes measured his steady progress. Then, the mass on the bleachers leaned toward the finish, lips bitten, fists clenched, and silently willed every swimmer’s hand hit to the wall.

What is the audience’s attitude toward Tyrese in lane eight?

The audience is bored and indifferent about Tyrese’s effort.
The audience is judgmental and unkind toward Tyrese.
The audience is interested and supportive of Tyrese.
The audience is helpful and instructive toward Tyrese.

Answers

Answer:

tHE ANSWER IS c

Explanation:

The audience is interested and supportive of Tyrese

Answer:

C

Explanation:

it is right on edge2020

Read the excerpt from "The Storyteller." A dissentient opinion came from the aunt. "A most improper story to tell to young children! You have undermined the effect of years of careful teaching." Which statement best explains the aunt's reaction to the bachelor in the excerpt?

Answers

This question is missing the options. I've found them online, they are the following:

Which statement best explains the aunt's reaction to the bachelor in the excerpt?

A) The aunt disapproves of the bachelor's story because the children like it better than the stories she tells.

B) The aunt is pleased with the bachelor's story because it entertains the children, but she disapproves of the story's message.

C) The aunt disapproves of the bachelor's story because she disagrees with the moral message it gives to the children.

D) The aunt is displeased with the bachelor's story because it fails to entertain the children.

Answer:

The statement that best explains the aunt's reaction is:

C) The aunt disapproves of the bachelor's story because she disagrees with the moral message it gives to the children.

Explanation:

In Saki's "The Storyteller", a bachelor shares a train carriage with an aunt and her nieces and nephew. Since the children are restless, the aunt tries to entertain them with a story that conveys a moral lesson about being good. Her story, however, is not only uninteresting, but also quite flawed in the way it teaches such lesson.

The bachelor decides to tell a story as well. To everyone's surprise, his is much more entertaining. He is also able to answer the children's questions satisfactorily. However, the aunt disapproves of his story once he is done telling it. Unlike hers, the bachelor's story conveys the message that being good can lead to bad things. The main character in his tale is an obedient young girl who ends up getting killed by a wolf. The aunt thinks such a lesson will ruin everything she and others have been trying to teach the children.

Discussion Topic
Poetry and drama can each present its own set of challenges in reading comprehension. While you explored literature from the English Renaissance, you probably encountered some obstacles in understanding the texts.

Think about the students who will take this course in the coming years. What advice would you give to help them prepare for reading plays, sonnets, and poetry of the Renaissance? What types of challenges would you prepare them to face? Consider different strategies that they might use to gain a better understanding of the text.

Answers

Answer:

Students are bound to not understand the poems. Times have changed and english has evolved. If you don't understand something, that's okay. If needed, dictionaries are at the touch of your fingertips. Use context clues or take notes. Break down the sentence or phrase and then put it back together and rewrite it, in your own words.

Why do people enjoy story telling

Answers

This is my opinion.

I believe people LOVE storytelling because it is not only entertaining to the story teller but also the listener. It can be fun learning more about someone or about something. Plus, the storyteller can say what they feel. It is calming for the listener and the storyteller.

I hope this helps! This is just my opinion and I hope this made sense :)

Select the letter of the term that identifies the function of the
phrase in parentheses in the following sentence:
Americans (enjoying the twice-fried potato snacks) thought they
were being served by the French; the snacks were actually made by
French-speaking Belgians.
a. adjective e. object of a preposition
b. adverb f. direct object
c. subject g. indirect object
d. predicate nominative h. appositive

Answers

Answer:

A. Adjective

Explanation:

The given phrase functions as an adjective as it describes the noun Americans. We can confirm this by the fact that it can be substituted by an adjective clause - a subordinate clause that functions as an adjective in the sentence:

Americans enjoying the twice-fried potato snacks thought they were... =  Americans who were enjoying the twice-fried potato snacks thought they were...

Adverbs are words used to modify verbs, adjectives, and other adverbs.

The subject is what the sentence is about.

The predicate nominative is a word or phrase that follows a linking verb and complements the subject of the sentence by renaming it or describing it (e.g. John is a good teacher).

The object of a preposition is a word that follows a preposition and completes its meaning.

A direct object is the receiver of the action represented by the verb.

An indirect object is a recipient of the direct object (She bought him a gift).

An appositive is a noun or a noun phrase that renames another noun right beside it.

list four ways to send clearer messages when speaking​

Answers

Answer:

Descriptive words, Complex lettering Eye contact, Calm body

Answer:

In person Messages (like when talking to someone)

-Look the person in the eyes when you are talking.

-If the person isn't paying attention wait for them to give you their full attention.

-Make sure you know what you are going to say before you start talking.

-Make sure you are prepared to answer any or all questions that come up after you are done with the message.

Online messages (Emails, Essays, Projects)

-Always, always check your grammar, spelling, and punctuation.

-Check that you are pronouncing things accurately.

-Check to make sure your work meets the requirements.

-If you have a sudden idea but aren't sure you will use it right away, write it down on a sticky note or somewhere safe you wont, loose or forget about it, just in case you may need it later.

It was the first day of October, and the bushes fairly danced with birds. The sun was out again after the rain, slanting low and golden beneath the clouds, warming the west-facing wall and the bushes in front of it. Mandy watched, fascinated, as the small gray birds hopped on the swaying branches. They stretched their wings, shaking them up and down fast, and puffing out their chests. Revving their motors, Mandy thought. They're getting ready to fly south and savoring what's left of summer, just like me. "Take me along," she whispered. Question Why are the bushes dancing? Answer options with 4 options 1. This is a fantasy in which bushes can dance. 2. The wind is blowing hard through the bushes. 3. Mandy is shaking the branches to make them dance. 4. The birds are hopping around in the branches.

Answers

Answer:

The bushes are dancing because:

4. The birds are hopping around in the branches.

Explanation:

The passage we are analyzing here clearly states that it is because of the birds that the bushes seem to be dancing:

[...] and the bushes fairly danced with birds.

[...] as the small gray birds hopped on the swaying branches.

The birds are hopping, stretching their wings, puffing out their chests, all the while making the bushes' branches sway. Why does the author use the word "dancing" to describe the movement of the branches, then? This is a technique called personification. Bushes cannot dance but, by saying so, the author conveys the idea that the way the bushes are moving is beautiful, rhythmic, hypnotizing, just like dancing.

I need help with this English assignment from the book (located down below) Tuesdays With Morrie an old man, a young man, and life's greatest lesson By Mitch Albom. The assignment I need help on is... please write a ONE sentence summary of each chapter. This is harder than you may think. Label each sentence summary with the title of the chapter This week's assigned chapter reading:
Taking Attendance
The First Tuesday
The Second Tuesday
The Third Tuesday
The Audiovisual, Part Two
The Professor

Answers

Answer:

Taking Attendance-  

Mitch was in London and when he went back to Detroit he found out that there was a protest against the union, and he was out of a job.

The First Tuesday-  

Mitch was talking to Morrie at his house about caring for strangers and how Morrie would still watch the news even though he won’t live to see the problems to be fixed.

The Second Tuesday-

Mitch went to Morrie’s house and they talked about how the disease Morrie had was spreading fast and how Morrie wanted to live out the rest of his life.

The Third Tuesday-

Mitch again went to Morrie’s house and this time he recorded the things Morrie and he talked about which consisted of pretty much everything in life.

The Audiovisual, Part Two-

Morrie had a follow-up interview with Ted Koppel and he could barely speak and he talked about his friend going deaf and a teacher who only taught people who lost a parent.

The Professor-

This chapter mostly talks about Morrie’s childhood and it talked about what happened during his childhood leading up to when he was a teen and he had gotten a job as a teacher.

Other Questions
How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important. PLEASE HELPPP1) Briefly describe the process of DNA replication. a) Start with the molecular machinery and be sure to describe what DNA polymerase does. Use the terms free nucleotides, helicase, polymerase, complementary.b) describe the result; how many strands were made? Describe their composition. Use the terms parental DNA and new DNA. What was the impact of the petition of right? The model represents an equation. What value of x makes the equation true? I have no idea what these notes are can someone please help! These are violin notes. If you want to ensure that a particular application receives priority access to the network, you should configure what feature on the router? QoSDHCPUDPARP