What number is an interger?

Answers

Answer 1

Answer:

21, 4, 0, and −2048 are intergers

Step-by-step explanation:


Related Questions

The cast of the play had a party. The drama teacher served 20 cookies and 40 carrot sticks as refreshments. Each cast member ate the same number of whole cookies and the same number of carrot sticks. Nothing was leftover. The drama teacher did not eat. How many cast members must have been at the party?

Answers

Answer:

20 cast members

Step-by-step explanation:

Each cast member must've ate 1 cookie and 2 carrot sticks.

WHAT IS 52÷467 I NEED TO KNOW CAUSE I HAVE TO GET MY GRADES UP

Answers

Answer:

.1113490364

Step-by-step explanation:

this is the answer.

Describe the parametric equations which traces the unit circle starting (-1,0) in a clockwise direction.

Answers

Step-by-step explanation:

There are several ways we can do this.

x = cos t, y = sin t, t ≥ 0 traces the unit circle in a counterclockwise direction starting at (1, 0).

To change the direction, we can multiply one of these by -1.  Then choose an initial value of t so that the starting point is (-1, 0).

x = -cos t, y = sin t, t ≥ 0

x = cos t, y = -sin t, t ≥ π

Or, we can change the direction by switching the equations.

x = sin t, y = cos t, t ≥ 3π/2

We can also multiply both by -1:

x = -sin t, y = -cos t, t ≥ π/2

Of these four examples, I would say the first is the simplest and most straightforward, but all of them achieve the same result.

During a football game, a team lost 9 yards on the first play, then gained 3 yards on each of the next 3 plays. Which integer represents the total number of yards at the end of the first four plays? z ​

Answers

Answer:

12

Step-by-step explanation:

So The team lost 9 yards. -9

Then they GAINED 3 yards on EACH of the next 3 plays. 3+3+3=9.

Technically on the 4 one it would be; 12

if 3 kg of beans cost $1.50, how much does two kg cost?

Answers

Answer:

$1

Step-by-step explanation:

1.50/3=0.5

unit price is $0.5

$0.5 * 2 kg = 1

Answer:

$1

Step-by-step explanation:All you do is divide 1.5 by 3 and you get .5 and because you need the cost for 2 kg you would add .5+.5=1

which point is on her graph? A. (1, 10) B. (22, 3) C. (6, 34) D. (2, 20)

Answers

Answer:

There is no picture

Step-by-step explanation:

I wanted to help but i cant

Answer:Its D

Step-by-step explanation: (6, 34)

can you pls help 0.0198 x 75=

Answers

Answer:

1.485

Step-by-step explanation:

just put it in a calculator if you dont have one google does.

the owner of an apple orchard ships apples in boxes that weigh 2 kilograms ( kg ) when empty. the average apple weighs 0.25 kg and the total weight of a box filled with apples is 12 kg. how many apples are packed in each box?

a. 14
b. 30
c. 40
d. 56

Answers

Given parameters:

Weight of box = 2kg

Average weight of an apple  = 0.25kg

Total weight of box filled with apples  = 12kg

Unknown:

Number of apples packed in each box = ?

Solution:

    Since 1 apple weighs 0,25kg, let us find the weight of the apples in the box

Box + apples  = 12kg

weight of box = 2kg

    Weight of apples  = 12kg - 2kg = 10kg

 So;

          0.25kg is the weight of 1 apple;

            10kg  of apples will equal     [tex]\frac{10}{0.25}[/tex]   = 40 apples

Therefore, 40 apples are packed in the box

Need Help please i will mark brainliest when it lets me

Answers

Answer:

The answer is C, reflection over the y-axis.

Step-by-step explanation:

It is reflection because everything was flipped over the y-axis.

WILL MARK BRAINLIEST Find the coordinates of the points of intersection of the graphs with coordinate axes: c y=− 1/4 x+2

Answers

Answer:

the y intercept is (0,2) and x intercept is (8,0)

Hope this helps

Picture linked

order these numbers from least to greatest, 4.509, 4.58, 4.09, 4.58258

Answers

Answer:

4.09,4.509,4.58,4.58258

Step-by-step explanation:

what is an equivalent expression for 1/4x
please help ASAP.​

Answers

Answer:

x/4

Step-by-step explanation:

Given x∥y and m∠2=23° . What is m∠7? WILL GIVE BRAINLIEST THANKS

Answers

Answer:

157

Step-by-step explanation:

180-23=157

Brent bought 8 potted plants for his co-workers. Each plant cost $5.76. How much money did he spend on his co-workers?
A.
$45.98
B.
$46.08
C.
$40.32
D.
$47.08

Answers

Answer:

B: $46.08

Step-by-step explanation:

There are 8 co-workers, and each plant costs $5.76, so we multiply 8*5.76 to get $46.08.

Answer:

B

Step-by-step explanation:

because $5.76×8=$46.08

What multiples for 90 and adds up to -23 ?

Answers

Easy buddy...

_________________________________

Step (1)

I choose a number which is x

_________________________________

Step (2)

Multiplies by 90 :

[tex]90x[/tex]

_________________________________

Step (3)

Adds up to -23 :

[tex]90x - 23[/tex]

_________________________________

And we're done.

Thanks for watching buddy good luck.

♥️♥️♥️♥️♥️

Tommy, Joel, and garret shared a supreme pizza from pizza kingdom. Tommy ate 3/8

Answers

Answer:

I would love to answer this question but i dont think you wrote out the whole thing.

Step-by-step explanation:

A man has painted 1/5 of a tower. He started at the tower's base and is now 35 feet above the ground. How tall is the tower?

Answers

Answer:

175 ft

Step-by-step explanation:

5 sections

1 is equal to 35ft

multiply 35×5

In order to understand more about the home internet access of a university with 12768 students, three staff members set out to sample a number of students. Below are their plans for sampling the students. Plan 1: One staff member thought that internet access could be different based on the size of the town/city where the student lives, so she obtained a list of all students at the university, divided them into three groups, students living in small-, medium-, and large-sized towns. 10% of students lived in small towns, 40% lived in medium-sized towns, and 50% lived in large-sized towns, so she randomly selected 20 of the students from small towns, 80 from medium-sized towns, and 100 from large-sized towns. Plan 2: The other staff member decided that it would be most efficient to contact students through the online course management system. He randomly sampled 20 courses from the course catalog, and contacted all students in each of these 20 courses through the online course management system. (You may disregard the negligible probability that some student was enrolled in more than one of these 20 courses.) Plan 3: The last staff member had access to a list of students that lived in the dorms, and used a computer program to randomly select 250 students from this list. The staff members took care not attempt to influence student responses in any way. Which of these three plans will result in representative samples of the population of students, on aver

Answers

Answer: I-

ok

Step-by-step explanation:

follow me on tktk

charlidamelio

Which pair of angles shares ray a f as a common side?

Answers

Answer:

it's the last one.

Step-by-step explanation:

both of them have ÀF as part of their angle.

Answer:

Step-by-step explanation:

it would the the second one

-6y-3x=-18 for x and y

Answers

The answer fam is..... X = 6 - 2y, Y = 3 - x/2

Jeff’s annual salary is $34,540. What is his semi-monthly salary?

Answers

Answer:

2,878.33333333

Step-by-step explanation:

i need answers , pls !!

Answers

abcdefghijklmnopqrstuvwxyz

What is the cross section that results from a plane intersecting exactly three vertices of a cube?

Answers

Answer:

An equilateral triangle cross section can be obtained by cutting the cube by a plane defined by the midpoints of the three edges emanating from any one vertex.

The area of this figure
20 in. is
square inches
28 in.
30 in.
7 in.
25 in.

Enter
Answer​

Answers

Answer:

20.40,28.59,30.60,25.50 is the units if the area

Step-by-step explanation:

mark me BRAINLIEST

Find the valve of x

Answers

Answer: C. 3

Step-by-step explanation:

As you can see, the numbers on the side are being multiplied by 2

so the inside of the triangle would be 3 since 3x2=6

Answer:

the answer is c

Step-by-step explanation:

If f(x) = 6x2 - 4 and g(x) = 2x + 2, find (f - g)(x).
Please help! It is algebra 1

Answers

12x^3+12x^2-8x-8

This is because you use the distributive property and you put g(x) first because you go from the inside out.

Select the correct answer. Which number is a zero of h(x) = (x2 − 81)(x + 4)
A. 0
B. 4
C. 9
D. 81

Answers

Answer:

9 is a zero of h(x). C. Correct

Step-by-step explanation:

We want to find the zeros of the function

[tex]h(x) = (x^2 - 81)(x + 4)[/tex]

The zeros are the values of x that make h(x)=0, thus we need to solve the equation:

[tex](x^2- 81)(x + 4)=0[/tex]

Factoring:

[tex](x^2 - 81)=(x-9)(x+9)[/tex]

[tex](x-9)(x+9)(x + 4)=0[/tex]

This equation has 3 solutions:

x=9, x=-9, x=-4

A. 0 is not a zero of h(x). Incorrect

B. 4 is not a zero of h(x). Incorrect

C. 9 is one of the zeros of h(x) calculated above. Correct

D. 81 is not a zero of h(x). Incorrect

Answer:

C) 9

Step-by-step explanation:

I had this question on a recent test and I got it right

I hope this helps! :)

pls help, will mark brainly

Answers

Answer:

Step-by-step explanation:

Another way to state it is to say that the sum of the lengths of any two sides of a triangle must be greater than the length of the third side. If you put the two shortest sides end to end, they have to be longer than the longest side to be able to angle up to form a triangle.

Answer:

3. 3, 5, 7

4. 1.1, 2.2, 3.2

5. 13, 5, 12

7. 5, 4, 3

8. 4, 4, 3

Step-by-step explanation:

In a triangle, the sum of the lengths of any two sides must be greater than the length of the third side.

1. 19, 16, 3

16 + 3 = 19

No triangle

2. 1, 2, 3

1 + 2 = 3

No triangle.

3. 3, 5, 7

3 + 5 = 8 > 7

3 + 7 = 10 > 5

7 + 5 = 12 > 3

Triangle

4. 1.1, 2.2, 3.2

1.1 + 2.2 = 3.3 > 3.2

2.2 + 3.2 = 5.4 > 1.1

1.1 + 3.2 = 4.3 > 2.2

Triangle

5. 13, 5, 12

13 + 5 = 18 >12

5 + 12 = 17 > 13

13 + 12 = 25 > 5

Triangle

6. 1, 7, 8

1 + 7 = 8

No triangle.

7. 5, 4, 3

5 + 4 = 9 > 3

4 + 3 = 7 > 5

5 + 3 = 8 > 4

Triangle.

8. 4, 4, 3

4 + 4 = 8 > 3

4 + 3 = 7 > 4

Triangle.

3. At an awards ceremony. 90 people are seated at 15 tables. If
there are the same number of people seated at each table, use
the ratio table to determine the number of people seated at each
table.

Answers

Answer:

5

Step-by-step explanation:

Answer:

6

Step-by-step explanation:

Which parent functions have a range of (-infinity , infinity) select all that apply
A. a parent even-degree power function
B. a parent odd-degree power function
C. a parent even-degree root function
D. a parent odd-degree root function
E. a parent exponential function with a base greater than 1
F. a parent exponential function with a base between 0 and 1
G. a parent logarithmic function with a base greater than 1
H. a parent logarithmic function with a base between 0 and 1

Answers

Answer:b,d,g,h

Step-by-step explanation:

A function assigns the value of each element of one set to the other specific element of another set. The correct option is B, D, G, and H.

What are the domain and range of a function?

A function assigns the value of each element of one set to the other specific element of another set.

The domain is the set of values for which the given function is defined.The range is the set of all values which the given function can output.

From the given functions the function that has a range of (-∞, ∞) can be found by plotting the graph. Therefore, the parent function that has a range of (-∞, ∞) are:

B. a parent odd-degree power function

D. a parent odd-degree root function

G. a parent logarithmic function with a base greater than 1

H. a parent logarithmic function with a base between 0 and 1

Hence, the correct option is B, D, G, and H.

Learn more about appropriate domain here:

https://brainly.com/question/20073127

#SPJ2

Other Questions
Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important.