What is the solution to the equation 3(y-2) = 2y-8

Answers

Answer 1

Answer:

y=-2

Step-by-step explanation:

3(y-2)=2y-8

3y-6=2y-8

3y-2y=-8+6

y=-2


Related Questions

Find the axis of symmetry for the function below.
2x^2 – 8x + 5 = 0

Answers

Your answer is (0,-3). The axis of symmetry is basically the y part in a vertex. I just found the vertex of the equation (showed you the steps how to do so if you don’t know) and then took the y value of the vertex-which is the axis of symmetry. Hopes this helps!

A study revealed a strong, linear, positive association between the amount of shampoo used and the length of hair. Another study revealed a strong, linear, positive association between amount of conditioner used and the length of hair. When the data were combined, the association became negative. What is this an example of?

Answers

Answer:

Step-by-step explanation:

B

Answer:

Simpson's Paradox

Step-by-step explanation:

The "cold start ignition time" of an automobile engine is being investigated by a gasoline manufacturer. The following times (in seconds) were obtained for a test vehicle: 1.75, 1.92, 2.62, 2.35, 3.09, 3.15, 2.53, and 1.91. (a) Calculate the sample mean and sample standard deviation. (b) Construct a box plot of the data.

Answers

Answer:

(a) The sample mean and sample standard deviation are 2.415 and 0.5342 respectively.

(b) Shown below.

Step-by-step explanation:

The data set provided is:

S = {1.75, 1.92, 2.62, 2.35, 3.09, 3.15, 2.53, and 1.91}

(a)

Compute the sample mean and sample standard deviation as follows:

[tex]\bar x=\frac{1}{n}\sum\limits_{i}{x_{i}} =\frac{1}{8}\times 19.32=2.415\\\\\\s=\sqrt{\frac{1}{n-1}\sum\limits_{i}{(x_{i}-\bar x^{2})^{2}}}=\sqrt{\frac{1}{8-1}\times 1.9976}=0.5342[/tex]

Thus, the sample mean and sample standard deviation are 2.415 and 0.5342 respectively.

(b)

Use SPSS to form a Box plot.

Go to Graphs → Legacy Dialogs → Boxplot

A dialog box will open.

Select "Simple".

Select "Summaries for Separate Variable"

Press "Define"

Another dialog box will open.

Select the variable.

Press OK.

The box plot is attached below.

80 plus what equals 44??

Answers

Answer:

-36

Step-by-step explanation:

80 + (-36) = 44

The negative in the 36 allows it to be subtracted from 80

Answer:

80 + -36

Step-by-step explanation:

80 - 44 = 36

80 + -36 = 44

Convert 1_1/2 to a percent

Answers

Answer:

150%

Step-by-step explanation:

You have 1 hole 100% and half 50%

Answer:the fraction 48 can be converted to decimal by dividing 4 by 8 . It can be converted to percent by multiplying by 100

Step-by-step explanation:

all the manz in my block have a glock ahhhhhh

Suppose John has 6.93 pounds of seed. If it takes 6.3 pounds of seed to plant one acre
can be planted?

Answers

Answer:

he can onle plant one.

Step-by-step explanation:

what exactly is the question.

Which equation is true when the value of x is -6

Answers

Answer:

x(4 + 4) + 16 = -32

Step-by-step explanation:

-6 times 4 is -24 so then you add -24 + -24 and get -48. Then if you add a positive 16 to the -48 you get -32.

Why is "3 meals a day" a unit rate?
O It compares 1 meal to 1 day.
O It compares 1 meal to 3 days.
O It compares 3 meals to 1 day.
Olt compares 3 meals to 3 days.

Answers

It compares 3 meals to 1 day!

Answer:

it compares 3 meals to 1 day

A square has a side length of 19 in. What is the area?

Answers

Answer:

A=a2=192=361in²

Step-by-step explanation:

Combine Like Terms: x^2 + y^2 + 3y^2 + 4x + 2x + 2 + 2

Answers

Answer:

x^2 + 4y^2 + 6x + 4

Step-by-step explanation:

Arranging the terms;

x ^ 2 + y^2 + 3y^2 + 4x + 2x + 2 + 2

x^2 + 4y^2 + 4x + 2x + 2 + 2

x^2 + 4y^2 + 6x + 2 + 2

x^2 + 4y^2 + 6x + 4

Complete the following truth table. Use T for true and F for false.
what is the answer

Answers

the answer is....

f
t
t
f
mark me brainliest or else

Manatees are an endangered species of herbivorous, aquatic mammals found primarily in the rivers and estuaries of Florida. As part of its conservation efforts, the Florida Fish and Wildlife Commission records the cause of death for every recovered manatee carcass in its waters. Of the 392392 recorded manatee deaths in 2012, 6868 were perinatal and 8181 were caused by collision with a watercraft. (a) What is the probability that the death of a randomly selected manatee was due to collision with a watercraft? (Enter your answer rounded to four decimal places.)

Answers

Answer:

Other question are " (b) What is the probability that the death was not due to collision with a watercraft? (Enter your answer rounded to four decimal places.) P(not collision) - (c) What is the probability that the cause of death was due to perinatal problems or collision with a watercraft? What is the

(c) What is the probability that the cause of death was due to perinatal problems or collision with a watercraft? What is the probability that it was due to some other cause? (Enter your answers rounded to four decimal places.) P(perinatal or collision) P(other cause) -"

a) P(collision) = Number of deaths caused by collision / Total number of deaths

P(collision) = 81/392

P(collision) = 0.2066

b) P(not collision) = 1 - P(collision)

P(not collision) = 1 - 0.2066

P(not collision) = 0.7934

c) P(perinatal or collision) = (68+81)/392

P(perinatal or collision) = 0.3801

P(other cause) = 1 - 0.3801

P(other cause) = 0.6199.

Help please.... I have got this wrong 2xs only once chance left

Answers

Answer:

a: 5x-1 = -6

b: 5x-1 = -6

        +1   +1

5x = -5

divide

x = -1

Write an addition problem that has a sum of -4 3/5

Answers

Answer:

-4+(-4.6)

Step-by-step explanation:

What is the equation of the line that passes through the point (5,-7) and has a slope of negative 1

Answers

Answer:

y = -x - 2

Step-by-step explanation:

Use equation: y = mx + b, where "m" is the slope and "b" is the y intercept. You are given a slope of -1 for the m. This is usually expressed as just a "-", as the 1 is inferred.

Since you are given a point, plug the x and y values in to the equation.

-7 = -(5) + b

Solve for b:

-7 = -5 + b

-2 = b

Knowing "m" and "b", plug these in to get your final equation

y = -x - 2

someone help please ​

Answers

Answer:

16.     =

17.     <

18.     <

Step-by-step explanation:

Stella has 215 coins and 89 of them are nickels. Two-thirds of the remaining coins are pennies. How many pennies does Stella have?

A. 38
B. 42
C. 66
D. 84

Answers

Answer: 84

Step-by-step explanation:

215 - 89 = 126

126 divided by 3 = 42

42 x 2 = 84

( this was how my teacher taught me to do these kind of problems)

Hope this helps! <3

Answer:

The answer is 84

Step-by-step explanation:

got it right on edge :D

Solve the math problem. Make sure your answer has the correct number of significant figures.
10.9 - 8.264

Answers

Answer:

2.636

Step-by-step explanation:

10.900-08.264

ANSWER

2.636


10.9
- 8.264
2.636

The graph of a linear function is shown on the grid. What is the rate of change of y with respect to x for this function? Please hurry it’s urgent Thank you

Answers

Answer:

[tex] -0.2 [/tex]

Step-by-step explanation:

Given:

(-3, 3.6);

(5, 2)

Required:

Rate of change

SOLUTION:

Rate of change for the function is given as [tex] \frac{y_2 - y_1}{x_2 - x_1} [/tex].

Let,

[tex] (-3, 3.6) = (x_1, y_1) [/tex]

[tex] (5, 2) = (x_2, y_2) [/tex]

Rate of change = [tex] \frac{2 - 3.6}{5 - (-3)} [/tex]

[tex] = \frac{-1.6}{8} [/tex]

[tex] = -0.2 [/tex]

The rate of change of y with respect to x for this function is -0.2

Given :

The graph of a linear function is shown on the grid

To find the rate of change of y with respect to x , we need to pick two points from the graph

Two points are (-3,3.6)  and (5,2)

Lets apply slope formula to find out rate of change

[tex]slope =\frac{y_2-y_1}{x_2-x_1}\\slope =\frac{2-3.6}{5+3} \\slope = -0.2[/tex]

The rate of change of y with respect to x for this function is -0.2

Learn more :  brainly.com/question/24930128

Which graph shows the solution to this system of inequalities? 3x - y < 5 and x + y > 2( PLEASE HELP!! )

Answers

Answer:

D

Step-by-step explanation:

Just graph both inequalities and plug in 0 to see which way it goes.

If m 24 = 35º, find m_2 and m23.
А
00
2
4
.
m22 =
m23 =

Answers

Answer:

m22 answer will be in your book only

Train A is traveling at 70 mph to a destination 200 miles away. Train B will leave 20 minutes after train A. Train B will leave from Train A's destination and will head in Train A's direction. If Train B will be going at a speed 32 of Train A's, how long after Train A left will it take before Train B arrives at Train A's starting point? Round your answer to the nearest tenth of an hour

Answers

Answer:

The answer is "2.2 h"

Step-by-step explanation:

Speed of Train B:

[tex]= \frac{3}{2} \times 70 \ mph \\\\= 105 \ mph[/tex]

Train B is then moving on:

[tex]= \frac{200 \ miles}{ 105 \ mph} \\\\= 1.905 \ h\\[/tex]

Then it takes Train A to the left:

[tex]\to 1.905\ h + 20 \ min \\\\= 1.905 \ h +0.333 \ h \\\\= 2.238 \ h[/tex]

To get train B to the reference point of train A = 2.2 h    

Jefferson Middle School needs to see a 300% gain in PTO fundraiser
sales from last year. If they sold a total of $2,420 last year, how much do
they need to sell this year to meet their goal? *

Answers

Given parameters:

Percentage gain = 300%

Selling cost last year = $2420

Unknown:

Selling cost this year  = ?

Solution:

To solve this problem;

     Profit percent  = [tex]\frac{Selling cost this year - Selling cost last year}{Selling cost last year} x 100[/tex]

      300 = [tex]\frac{S - 2420}{2420} x 100[/tex]

      3 = [tex]\frac{S - 2420}{2420}[/tex]

         S- 2420 = 7260

          S = $9680

To make a 300% gain, Jefferson Middle school needs a $9680 from fundraiser sales this year.

2. During typhoon Ambo, PAGASA tracks the amount of accumulating rainfall. For the first three hours of typhoon, the rain fell at a constant rate of 25mm per hour The typhoon slows down for an hour and started again at a constant rate of 20 mm per hour for the next two hours. Write a piecewise function that models the amount of rainfall as function of time.​

Answers

Answer:

Kindly check explanation

Step-by-step explanation:

Given the following information:

First three hours of typhoon: rate of Rainfall. = 25mm per hour

Typhoon slows down for an hour : then Rainfall began again at a constant rate of 20 mm per hour for the next 2 hours

Piecewise function which models Rainfall ad a function of time

Amount of Rainfall as a function of time = f(t)

f(t) = 25t ; if t≤ 3

When typhoon slowed down for an hour :

f(t) = 0;

f(t) = 25*3 ; for t ∈ (3, 4)

Then Rainfall at a constant rate of 20mm for another 2 hours

f(t) = (25 *3) + 20(t - 4) ; for t ∈ (5, 6)

Sophie went to the lake with her family. First, they spent 1 1/4
hours fishing. Then, they spent twice as much time swimming. How much time did they spend fishing and swimming in all?
Write your answer as a whole number, fraction, or mixed number.

Answers

3 and 3/4 hours

(1 and 1/4 • 2) + 1 and 1/4

Answer:

2

Step-by-step explanation:

Holiday Inn charges its cost one dollar plus $.80 per minute for long distance calls. Across the street, La Quinta charges its guests $2 plus $0.75 per minute for long distance calls. Which equation correctly models the length of a call for which the two hotels charge the same amount

Answers


Answer: 1 + 0.80x = 2 + 0.75x
(Also x = 20)

1/2 (b + 2) + 3b = -1

Answers

Answer:

3 1/2b + 2 1/2=-1

Step-by-step explanation:

For every line there can exist a coplanar parallel line. true or false?

Answers

Answer:

T

Step-by-step explanation:

Plot the number 2.78 on a numberline between 2.7 and 2.8

Answers

Answer:

On the screenshot below, each little line represents 0.1. It's not labeled 2.7 and 2.8, but if you count the tick marks by 0.1, it shows that exact approximation.

I hope this helps!

Answer:

<│--------│----------│-----------│----------│----------│-----------│-----------│------------│------│>

2.7    2.71       2.72        2.73       2.74       2.75        2.76        2.77         2.78   2.8

Dilations always increase the length of line segments

True

False

Dilations increase the measure of angles.
Group of answer choices

True

False


Dilations of a triangle are similar to the original triangle.
Group of answer choices

True

False

Answers

1. False. Dilations can increase and decrease.
2. True
3 if you change the size of a triangle will the triangle be the same? So true. Because you are only changing the size of triangle.

I hope those helps
Other Questions
What are the similarities and differences between types of quadrilaterals? Plz help me in math exam ans his qnn i will mark as brainliesttt What has happened to our system of classification as technology has become moreadvanced? Which equation represents a line that is parallel to theline shown on the graph?Piz and ty PLEASE HELP ASAP 5 STARS AND BRAINLIEST TO WHOEVER DOES ALL OF THE PAGE The majority of Canadians live in rural areas. True or False Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first