Find the real-number root -81

Answers

Answer 1
The answer is 9 sorry if this is wrong

Related Questions

A line has a slope of 3 and goes through the point (6,-5). What is the equation of this line in Standard Form?
- 3x +y= 21
-3x +y= -23
- 3x +y = -13
3x +y = 13

Answers

Answer:

−3x+y=−23

Step-by-step explanation:

wow this is exactly 1 year ago from today

 -3x +y= -23  is the equation of this line in Standard Form .

What is in slope-intercept form?

Y = mx + b, which defines a line, is an equation's slope-intercept form. When a line is graphed, its slope, m, and its point of intersection with the y-axis, b, also known as the y-intercept, are shown. To find answers for x, y, m, and b, utilize slope intercept form.

m = 3

the point =  (6,-5)

the equation of this line

           y - y₁ = m ( x - x₁)

           y - ( -5 ) = 3 ( x - 6 )

           y + 5 = 3( x - 6 )

            y + 5 = 3x - 18

             y = 3x - 18 - 5

             y = 3x - 23

            -3x +y= -23

Learn more about slope-intercept form

brainly.com/question/9682526

#SPJ2

Answer this for BRAINLIEST !

Answers

Answer:

-1/3

Step-by-step explanation:

Rebecca writes 1/5 of a page in 1/14 minute. How many pages can she write in one minute? (fraction) pages per minute.

HELP I BEG!!

Answers

Answer:

She can write 2 pages and 4/5 extra.

Step-by-step explanation:

We know that she has already written for 1/14 of a minute. Now we need to turn that fraction into a whole, because the problem is asking for a whole minute.

___ x 1/14 = 1?

14

Now we take the 1/5, and multiply it by the 14 to see how much she writes in a minute.

1/5 x 14 = 14/5

Last we simplify.

14/5 = 2 4/5

-8x-3=13-9x what is the answer for x?

Answers

Answer:

x=16

Step-by-step explanation:

-8x-3=13-9x

-8x+9x=13+3

x=16

Answer:

x = 16

Step-by-step explanation:

subtract 8x from both sides

-3 = 13 -x  subtract 13 to both sides

-16 = -x multiply both sides by -1 which gives you 16 = x

A rocket is launched from the launch pad at a speed of 700 km/hr. How far will the rocket have traveled after 1.0 hr?

Answers

Step-by-step explanation:

The answer is

Distance is 42000 kmph

The distance the rocket has traveled after 1 hour with a speed of 700km/hour is 700 km.

Given,

A rocket is launched from the launch pad at a speed of 700 km/hr.

We need to find how far will the rocket has traveled after 1.0 hr.

What is speed?

Speed is the ratio of distance per time.

Speed = Distance /Time

Its unit is km/hour or m/second.

We have,

Speed = 700 km/h

Distance = D

Time = 1 hour

From the speed formula:

Speed = Distance / Time

700 = Distance / 1

700 km / hour x 1 hour = Distance

Distance = 700 km

Thus the distance the rocket traveled after 1 hour with a speed of 700km/hour is 700 km.

Learn more about relative speed here:

https://brainly.com/question/28224010

#SPJ2

Benjiro and Eren are playing Fortnite. Benjiro had 4 kills in 10 minutes. Eren had
3 kills in 8 minutes. If each player continues at the same rate, who will reach more kills in 40 minutes? How many kills will each player have? Explain you answer. *

Answers

Benjiro will have more kills in 40 minutes.

Benjiro - 16 kills

explanation - 10 goes into 40 four times, so 4x4= 16 kills

Eren - 15 kills

explanation - 8 goes into 40 five times, so 3x5= 15 kills

Answer:

Benjiro will have more kills because 40 divided by 10 is 4 so 4 times 4 is 16 while 3 times 5 is 15

Step-by-step explanation:

What two integers would v26 fall between

Answers

Answer:

Your answer is v25 and v26.

Step-by-step explanation:

I hope this helped, have a good day! ;)

Please help meeeeee????

Answers

Answer:

RT = 23

Step-by-step explanation:

We will have a line that essentially goes like this:

R-----S-----T

The distance from R to S is 12 units.

The distance from S to T is 11 units.

We need to find the distance from R to T.

R is the starting point and T is the ending point.

To find the total distance, we can add both line lengths.

12 + 11 = 23 units

Best of Luck!

5 less than triple the quotient of a number x and 7

Answers

Answer:

5 less than triple the quotient of a number x and 7 is 3(x ÷ 7) - 5

Pls does anyone know the answer I need it fast

Answers

Answer:

The first one is 120 and the second is 200

Step-by-step explanation:

The range value is the domain value times 40

how to get algebra help

Answers

What even is this question?

is -0.25 repeating rational

Answers

no it is terminating rational

who ever answers all these questions will get the brianlist and it has to be right please :)

Answers

0-Yellow

0.25-Green

-2-Blue

/-Green

π-Purple

I wish that answers your question

Thank You

Simplify the expression.
-10-6+)
12
12
12

Answers

it is 12 that is the answer

please show work i just don’t understand the wording

Answers

Answer:

they won 52 games

they lost 19 games

the equation is  2x + 33= 71

Step-by-step explanation:

they played 71 games in total

say the amount of games they won is y

say the amount of games they lost is x

using the variables, you can form this equation:

y + x = 71

you also know that they won 33 more games then they lost.

so, y = x + 33

now, you can substitute y for x + 33 in the original equation

x + x + 33 = 71

combine like terms

2x + 33 = 71

subtract 33 from both sides of the equation

2x + 33 - 33 = 71 - 33

2x = 71 - 33

2x = 38

divide both sides of the equation by 2

2x/2 = 38/2

x = 38/2

x = 19

they lost 19 games.

now substitute 19 for x in the equation

y = x + 33

y = 19 + 33

y = 52

they won 52 games

what is the answer to 20x+7=4+6?

Answers

Answer:

Step-by-step explanation:

Answer:

0.15

Step-by-step explanation:

20x+7=10

20x=10-7

20x=3

x=3/20

x=0.15

Cayenne bought 20 pencils for 1.60 dollars at that rate how much would 35 pencils cost ​

Answers

35 pencils would cost $2.80,


$1.60 / 20 = $.08
Each pencil costs $0.08 each

.08 * 35 = 2.80

Figure MNOP is reflected about the x-axis to obtain figure M′N′O′P′:

A coordinate grid is shown from negative 4 to 0 to 4 on both x- and y-axes. A polygon MNOP has M at ordered pair 1, 3, N at ordered pair 2, 1, O at ordered pair 3, 1 P at ordered pair 4 and 2. A polygon M prime N prime O prime P prime has M prime at 1, negative 3, N prime at ordered pair 2, negative 1, O prime at ordered pair 3, negative 1, and P prime at ordered pair 4, negative 2.
Which statement best describes the relationship between the two figures? (1 point)

Figure MNOP is bigger than figure M′N′O′P′.
The measure of angle O is equal to the measure of angle M′.
The measure of angle O is equal to the measure of angle P′.
Figure MNOP is similar to figure M′N′O′P′.

Answers

Figure MNOP is similar to figure M'N'O'P'.

Answer:

Figure MNOP is similar to figure M'N'O'P'.

Step-by-step explanation:

hope this helped :)

Which of the following describes a square root of 41 ?
A Between 20 and 21
B Between 40 and 42
C Between 6 and 7
D Between 5 and 6

Answers

Answer

C

Step-by-step explanation:

FIND THE VALUE OF X AND W my answer is incorrect
PLEASE HELP ME
geometry

Answers

Step (1)

[tex](6w - 7) + (3x + 8) = 142[/tex]

[tex]6w + 3x - 7 + 8 = 142[/tex]

[tex]6w + 3x + 1 = 142[/tex]

Subtract sides -1

[tex]6w + 3x + 1 - 1 = 142 - 1[/tex]

[tex]6w + 3x = 141[/tex]

Divided sides by 3

[tex] \frac{6}{3}w + \frac{3}{3}x = \frac{141}{3} \\ [/tex]

[tex]2w + x = 47[/tex]

I call above equation (( Ω ))

_________________________________

Step (2)

[tex]180 - 142 = 38[/tex]

We have :

[tex](6w - 7) + 38 = (10w - 9)[/tex]

[tex]6w - 7 + 38 = 10w - 9[/tex]

[tex]6w + 31 = 10w - 9[/tex]

Subtract sides -6w

[tex]6w - 6w + 31 = 10w - 6w - 9 \\ [/tex]

[tex]31 = 4w - 9[/tex]

Plus sides 9

[tex]31 + 9 = 4w - 9 + 9[/tex]

[tex]40 = 4w[/tex]

Divided sides by 4

[tex] \frac{40}{4} = \frac{4}{4}w \\ [/tex]

[tex]w = 10[/tex]

_________________________________

Do u remember (( Ω )) ?

Of course u do...

[tex]2w + x = 47[/tex]

[tex]2(10) + x = 47[/tex]

[tex]20 + x = 47[/tex]

Subtract sides -20

[tex]20 - 20 + x = 47 - 20[/tex]

[tex]x = 47 - 20[/tex]

[tex]x = 27[/tex]

_________________________________

And we're done.....♥️♥️♥️♥️♥️

PLS HELP ILL GIVE BRAINLIEST I NEED NOW

What is the value of 'x' in the figure of the square below?

Answers

Answer:

3

Step-by-step explanation:

so you set up an equation because the sides are equal

10+x=4x+1

then you solve

10=3x+1

9=3x

x=3

Complete the following equality. 11 ft = in.

Answers

Answer:

11 ft =132in

Step-by-step explanation:

first u multiply the length value which is 12

11 x 12 = 132

-6 + 14 - 9 - (-3) + 8

Please help

Answers

Answer:

10

Step-by-step explanation:

−6+14−9−(−3)+8

=8−9−(−3)+8

=−1−(−3)+8

=2+8

=10

-6 + 14 - 9 - (-3) + 8

8 - 9 - (-3) +8

-1 + 3 + 8

2 + 8

10

What is the product of the polynomial 2x^3 + 8x^2 + x + 3 times the
monomial x?

Answers

Answer:

[tex]\huge\boxed{2x^4 + 8x^3 + x^2 + 3x}[/tex]

Step-by-step explanation:

When we multiply a polynomial by a specific monomial, all terms in the polynomial get multiplied by the monomial.

So we can do this by term.

[tex]2x^3 \cdot x[/tex]

Multiplying x by x to the something power will just increase the exponent on the x term by one (since powers are just x multiplied by itself). This means the exponent here will increase by 1, so this becomes [tex]2x^4[/tex].

Same logic applies to the second term: [tex]8x^2[/tex], raise the exponent by one, [tex]8x^3[/tex].

For the third term, if there is no exponent on a term you can assume it's exponent is 1 (so [tex]x^1[/tex] in this case - as [tex]x^1=x[/tex]). Again, using the same logic, this turns into [tex]x^2[/tex].

For the last term, when we multiply a constant by a variable, we get a term with a variable and a coefficient - the constant becomes the coefficient and the variable stays the variable. Therefore, [tex]3 \cdot x = 3x[/tex].

Adding these terms all together gets us [tex]2x^4 + 8x^3 + x^2 + 3x[/tex].

Hope this helped!

please explain this someone

Answers

Answer:

A. x=5

B. Look at image for answer

Step-by-step explanation:

No she is not correct.

Since both angles have the same measurement you set them equal to each other as so & solve for x

2x+90= x+95

x+90=95

x=5

In order to find the angle measurements you plug in 5

2(5)+90

10+90

= 100 degrees

Supplementary angles add up to 180 degrees so the angle next to the 100 degree one is 80 degrees

true or false for k = 4 in 32÷k=8​

Answers

Answer:

True

Step-by-step explanation:

Answer:

TRUE!

Step-by-step explanation:

Solve for Y........................

Answers

11 squared is 121
20 squared is 400
121+400= 521
The approximate square root of 521 is approximately 22.8254

14.89 divided by 0.02

Answers

Answer:

744.5

Step-by-step explanation:

Answer:

744.5

Step-by-step explanation:

the answer is 744.5

The table shows the number of tennis balls that fit into a given number of cans

Answers

Answer:

wheres the table?

i cant see the table

The table shows nothing because the table doesn’t exist, can we see the table

During the summer, Tyler delivers packages and Miranda cares for animals on a farm. To show their earnings, Tyler makes a graph and Miranda makes a table. Which statement is true?

Answers

Answer:

When Miranda works 5 hours instead of 4, her pay goes up by

 $56.00 - 44.80 = $11.20

That is, Miranda is paid $11.20 for each hour she works.

The slope of Tyler's graph indicates he is paid $9.00 for each hour he works. Miranda's pay per hour is $11.20 - 9.00 = $2.20 more than Tyler's.

Miranda earns $2.20 more per hour than Tyler

Other Questions
What has happened to our system of classification as technology has become moreadvanced? Which equation represents a line that is parallel to theline shown on the graph?Piz and ty PLEASE HELP ASAP 5 STARS AND BRAINLIEST TO WHOEVER DOES ALL OF THE PAGE The majority of Canadians live in rural areas. True or False Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture