Find the missing factor.
80 X
640.000

Answers

Answer 1
The answer is 8.
640 / 80 =. 8
80 x 8 =. 640

Related Questions

Please put the following numbers in order from smallest to largest: 12% 4/28 0.15

Answers

12%, 4/28, 0.15

Pretty simple.

Answer:

12%<4/28<0.15

Step-by-step explanation:

12%=0.12

4/28=1/7=0.143

0.15

I put a pic of question here. I'm in 8th grade

Answers

y = 115

x = 78

The angles in each line have to add up to 180. In this case, it doesn't show the other side of the angle, but you could probably think of it.

What do the zero exponent and negative exponent properties mean.

Answers

Answer:

Negative exponents put the exponentiated term in the denominator of a fraction and zero exponents just make the term equal to one.

Step-by-step explanation:

Answer:

Step-by-step explanation:

Primero, cualquier número elevado a la potencia cero es uno. Segundo, los exponentes negativos indican una disposición. Si un exponente es negativo, necesita moverse de donde está al numerador o denominador. Investigaremos esta propiedad más adelante en el Conjunto de Problemas.

Does anyone know what the answer is?​

Answers

Answer:

0.974.

Step-by-step explanation:

You have to use a correlation calculator.

fill the missing number to make each expression equal. +2=16+3?

Answers

Answer:

14

Step-by-step explanation:

14+2=16+3

Answer:

Number Operation =

given that the equation we must maintain the similarities. so that :

15 - 2 = 20 - 7

13 = 13

a + 2 = 16 + 3

a + 2 = 19

a = 19 - 2

a = 17

13 - 6 = b - 9

7 = b - 9

7 + 9 = b

b = 16

10 . 6 = 15 . c

60 = 15c

c = 60/15

c = 4

10/d = 20/4

10/d = 5

d = 10/5

d = 2

.

13. What is the width of a rectangle with length 14 cm and area 161 cm??

Answers

[tex]\huge\red{Question}[/tex]

what is the width of a rectangle with length 14 Cm and area 161 Cm^2?

[tex]\huge\green{Answer}[/tex]

Area = width * length

161 = W * 14

W = 161/14 = 11.5

Answer: width of rectangle is W = 11.5 cm

ӇƠƤЄ ƖƬ ӇЄԼƤƧ❤

Uh, uh, uh, uh

Day and night (what, what)
I toss and turn, I keep stressing my mind, mind (what, what)
I look for peace but see I don't attain (what, what)
What I need for keeps this silly game we play, play
Now look at this (what, what)
Madness to magnet keeps attracting me, me (what, what)
I try to run but see I'm not that fast (what, what)
I think I'm first but surely finish last, last

'Cause day and night
The lonely stoner seems to free his mind at night
He's all alone somethings will never change
The lonely loner seems to free his mind at night (at, at, at night)

At, at, at, at, at, at night
At, at, at, at, at, at night

Hold the phone (what, what)
The lonely stoner, Mr. Solo Dolo (what, what)
He's on the move can't seem to shake the shade (what, what)
Within his dreams he see's the life he made, made
The pain is deep (what, what)
A silent sleeper you won't hear a peep, peep (what, what)
The girl he wants don't seem to want him to (what, what)
It seems the feelings that she had are through, through

'Cause day and night
The lonely stoner seems to free his mind at night
He's all alone through the day and night
The lonely loner seems to free his mind at night (at, at, at night)
Day and night
The lonely stoner seems to free his mind at night
He's all alone, some things will never change (never change)
The lonely loner seems to free his mind at night (at, at, at night)

Day and night
The lonely stoner seems to free his mind at night
He's all alone somethings will never change
The lonely loner seems to free his mind at night (at, at, at night)

At, at, at, at, at, at night
At, at, at, at, at, at night
At, at, at, at, at, at night
At, at, at, at, at, at night

Answers

Answer:

is that a song you write cause it is good

Step-by-step explanation:

Step-by-step explanation:

My favorite Kid Cudi song, without a doubt. It was one of those songs that was such a huge part of my childhood that I forgot about until maybe a year ago, when I relistened to some Kid Cudi projects and rediscovered this gem. Production's phenomenal, the atmosphere is super fitting when compared to the lyrics, and Cudi's voice works great here.

Whats x solve 1/3x-2/3=-18

Answers

Answer:

[tex]x=-52[/tex]

Step-by-step explanation:

multiple everything by 3 to get rid of the fractions

[tex]3(1/3x-2/3=-18)\\1x-2=-54\\[/tex]

rewrite

[tex]x-2=-54[/tex]

add 2 to both sides

[tex]x-2+2=-54+2\\x=-52[/tex]

Answer:

[tex]x=-52[/tex]

Step-by-step explanation:

[tex]\frac{1}{3} x-\frac{2}{3} =-18[/tex]

Add [tex]\frac{2}{3}[/tex] to both sides of the equation:

[tex]\frac{1}{3} x=-18 +\frac{2}{3}[/tex]

Simplify [tex]-18+\frac{2}{3}[/tex] by multiplying [tex]-18[/tex] in fraction form [tex]-\frac{18}{1}[/tex] to get a common denominator so you can add the two fractions:

[tex]-\frac{18}{1}[/tex] × [tex]\frac{3}{3}=-\frac{54}{3}[/tex]

Now add the two fractions:

[tex]-\frac{54}{3} +\frac{2}{3} =-\frac{52}{3}[/tex]

Now write the simplified equation:

[tex]\frac{1}{3} x=-\frac{52}{3}[/tex]

Divide both sides of the equation by the coefficient of [tex]x[/tex], which is [tex]\frac{1}{3}[/tex]:

[tex]x=-\frac{52}{3}[/tex] ÷ [tex]\frac{1}{3}[/tex]

Use the reciprocal of the dividend ([tex]\frac{1}{3}[/tex]), and multiply by your divisor:

[tex]x=-\frac{52}{3}[/tex] × [tex]\frac{3}{1}[/tex]

[tex]x=-\frac{156}{3}[/tex]

Simplify the fraction by dividing [tex]-156[/tex] into [tex]3[/tex]:

[tex]x=-52[/tex]

A recipe says, “1 part cocoa to 4 parts sugar.” How much sugar will you need if you use 20 grams of cocoa

Answers

Answer:

80 grams

Step-by-step explanation:

because 1 part is cocoa and 4 parts sugar.

20= 1 part so all you have to do is multiply 20 by 4 and you get 80

Hope this helps!!

Answer:

80 grams

Step-by-step explanation:

4 times 20 is 80. it's like doing unit rate.

Johnny will work 15 hours a week during the l36 week school year, and 40 hours a
week the other 16 weeks of the year. How many hours will he work over the course
of the year?

Answers

15 hours for 36 weeks = 540 hours
40 hours for 16 weeks = 640 hours
540 + 640 = 1,180 hours total

giving 50 PONITS I MARK BRAINLIEST
the question is in the picture, its easy but I'm lazy, tyyy

Answers

Answer:

76,200

Step-by-step explanation:

move the decimal three places to the right

76,200

Answer:

7620

I hope this helps!

What is the slope of the line shown?

Answers

Answer:

The slope is 2, or 2/1

Step-by-step explanation:

If you count the rise/run, you get 4/2, which simplifies to 2/1, which is the same as 2.

During a thunderstorm​ yesterday, 600 millimeters of rain fell in 30 minutes. What is the unit rate for millimeters per​ minute?

Answers

9514 1404 393

Answer:

  20 mm/min

Step-by-step explanation:

To find the rate in mm per minute, divide mm by minutes:

  (600 mm)/(30 min) = 20 mm/min . . . unit rate

how does the percent equation help solve markup problems i will mark brainliest

Answers

Yo bro bro the answer is 65

One number is 4 times a first number. A third number is 100 more than the first number. If the sum of the three numbers is 280, find the numbers. The three numbers are:

Answers

Answer:  The first number is 30.

The second number is 120.

The third number is 130

Step-by-step explanation:

x + 4x + x+ 100 = 280

6x = 280-100

6x= 180

x = 30

6th grade math I mark as brainliest

Answers

Answer:

the second one I think

Step-by-step explanation:

dont come at me if it's wrong please

Answer:

8.962

Step-by-step explanation:

8×1+9×0.1+6×0.01+2×0.001

8+0.9+0.06+0.002

8.962

Show your work and write an expression by using these clues:
1. Write a number that is greater than 100, but smaller than 10,000
2. Divide that number by 10, 100 or 1,000
3. The quotient should be a number that is less than 100, but greater than 1

Answers

Answer: 10.1

Step-by-step explanation:

Step 1:  1,000 is greater than 100 but smaller then

Step 2:  10,000     1,000 is divided by 10,100 which =10.1                                                                  

Step 3:    and 10.1 is less than 100 greater than 1

Answer:10.1

Step-by-step explanation:

Step 1:  1,000 is greater than 100 but smaller then

Step 2:  10,000     1,000 is divided by 10,100 which =10.1                                                                  

Step 3:    and 10.1 is less than 100 greater than 1

Step-by-step explanation:

What is 5 plus 5 minus two plus three mines 17

Answers

Your question: 5+5-2+3


The answer would be: 11

Answer:

-6

Step-by-step explanation:

5+5=10 10-2=8 8+3=11 11-17=-6

Q:What is the scale factor of this dilation?
1. 1/2
2. 1/3
3. 2
4. 3

Answers

Answer:

C. 2

Step-by-step explanation:

You can figure it out by multiplying the pre-image by 2 resulting in the image

What is the value of -x² - 4x - 11 if x = -3​

Answers

Answer:

-74 your welcome

Step-by-step explanation:

The cost of shipping a package is $1.85 per pound. Karen has a package that has a mass of 8 kg. How much will it cost Karen to ship the package? Use 1 kg ≈ 2.2 lb

Answers

$32.56

Did she speak to the manager

Find the midpoint of the segment between (6,7) and (6,-5)

(0, -1)
(6,1)
(1,6)
(0, 1).
Helpppo pleasee

Answers

Answer:

(6,1)

Step-by-step explanation:

midpoint = ((x2+x1),(y2+y1)/2)

= (6+6)/2, (-5+7)/2

= 12/2, 2/2

= 6,1

Answer:

(6, 1)

Step-by-step explanation:

GivenSegment (6, 7) and (6, -5)To findMidpoint Solution

x- coordinates same so the line is vertical and we'll only calculate the y-coordinate

x= 6y = (7 + (-5))/2 = 2/2 = 1

So the point is

(6, 1)

The angle between 0° and 360° that is coterminal with the 664° angle is
degrees.

Answers

Answer:

it would be 0.5 degrees

show your work please hurry
−17 = x − 15

Answers

Answer:

x = -2

Step-by-step explanation:

-17 = x - 15

+15      +15

------------------

-2 = x

Answer:

-17=x-15, move the terms.
-x=-15+17, add them together.
-x=2, move the signs, and your answer is...
x=-2

Find the value of x.

The answer choices are: 5, 7, 3, 11, 9

Answers

Answer:

x = 3

Step-by-step explanation:

Hi there !

DBC + CBV = 180°

DBC + BDC + DCB = 180°  }=> VBC = BDC + DCB

replace

20x + 5 = 9x - 2 + 40

solve the equation

20x - 9x = 40 - 2 - 5

11x = 33

x = 33 : 11

x = 3

Good luck !

The fence is rectangular, so use the formula for the area of a rectangle: .

You know the area (A = 300 ft2) and the width (w = 4 ft), but not the length. The formula would be more useful if it were rewritten to solve for the length in terms of the area and width. Rewrite the formula by dividing both sides by the width.


Use the formula to find the length of fence (in feet) that can be painted.

Answers

Answer: New formula is A/w=l

Length equals 75ft.

Step-by-step explanation:

A=l x w           Area of a rectangle formula.

A/w=l              Solve for length

300=l x 4      

300=l x 4

4           4

300/4=l

75=l

The new formula is A/w=l and  Length= 75ft.

A=l x w        (Area of a rectangle formula)

A/w=l           (Solve for length)

300=l x 4      

300=l x 4

300/4=l

75=l

What's the vicinity system?

Given a rectangle with duration l and width w, the system for the location is A = lw (rectangle). that is, the place of the rectangle is the duration accelerated by the width. As a unique case, as l = w inside the case of a rectangular, the location of a rectangular with facet duration s is given with the aid of the formulation: A = s2 (rectangular)

The perimeter P of a rectangle is given through the formulation, P=2l+2w, wherein l is the period and w is the width of the rectangle. The location A of a rectangle is given with the aid of the system, A=lw, where l is the length and w is the width.

Learn more about the area of a rectangle here: https://brainly.com/question/25292087

#SPJ2

I WILL GIVE BRAINLIEST!!!

Answers

Answer:

C. -4

I hope this helps!

A company earns $175 a week for 10 weeks. It then has a loss of $87 a week for 15 weeks. At the end of the 25 weeks what is the company's balance?

Answers

Answer= 445
175 x 10 = 1,750
87 x 15 = 1305
1750-1305 =445

The product of 3 and 4 2/5

Answers

Answer:

here! I hope this helps :) the answer is 13.2 or 13 1 (upon 5)

Step-by-step explanation:

3 × 4 2 (upon 5)

=3× 22 (upon 5)

=66 (upon 5)

=13 1 (upon 5)

A contractor cut 28 feet of wire into sections that were feet long. How many pieces of wire did the contractor have?

Answers

Answer:

its 6

Step-by-step explanation

Other Questions
Which equation represents a line that is parallel to theline shown on the graph?Piz and ty PLEASE HELP ASAP 5 STARS AND BRAINLIEST TO WHOEVER DOES ALL OF THE PAGE The majority of Canadians live in rural areas. True or False Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids.