Fidgeting... * please help
a) makes the corners of the eyes crinkle.
b) always means someone is lying.
c) signals interest in another person.
d) sends signals of boredom or impatience.

Answers

Answer 1

The answer is D. sends signals of boredom or impatience.

Someone fidgeting is a nonverbal cue that means the person has boredom or impatience.

Answer 2
d, fidgeting is when you can’t stand sitting or doing something staying still

Related Questions

Which of the following sentences is structured correctly?

"Do you think . . ." Jasmine asked, "I should cut my hair to my chin or only trim it?"
"Do you think—" Jasmine asked, "I should cut my hair to my chin or only trim it?"
Jasmine asked, "Do you think I should cut my hair to my chin, or only trim it?"
Jasmine asked, "do you think I should cut my hair to my chin or only trim it?"

Answers

Answer:

Jasmine asked, "Do you think I should cut my hair to my chin, or only trim it?"

2 answers

Answer:

It's the 3rd answer

Explanation:

How do this photo and caption enhance the information provided in the book? They connect the book's ideas about the American bicycle industry. They offer an example of wealthy society's enthusiasm for bicycles. They provide insight about the English influence on American bicycles. They emphasize the idea that bicycles helped blur gender roles.

Answers

Question:

Dressing the Part – Frances Benjamin Johnston, above, might have raised a few eyebrows when she donned a man’s suit and a fake moustache for this self-portrait in the late 1800s. But the groundbreaking photographer was used to operating in a man’s world.

How do this photo and caption enhance the information provided in the book?

A. They connect the book’s ideas about the American bicycle industry.

B. They offer an example of wealthy society’s enthusiasm for bicycles.

C. They provide insight about the English influence on American bicycles.

D. They emphasize the idea that bicycles helped blur gender roles.

Answer:

The correct answer is D) They emphasize the idea that bicycles helped blur gender roles.

Explanation:

It is safe to say that the bicycle disrupted the social system as its popularity and adoption gave more freedom of expression and transportation to the female gender.

Suffice it to say that in the 18th century and prior to the invention of the bicycle, women were not as vocal, outspoken, and liberal as they are today.

Sue Macy the author of "Wheels of Change" makes a connection between this newfound technology and how it allowed girls and women to do things they couldn't do before.

For instance, if women could use the bicycle as a means of transport, then they could definitely use it as a form of sports.

History has it that with these developments, came a backlash from the male chauvinists. Some of their argument rested on how it was unladylike to move around on such a vehicle.

Of course, these didn't enervate the course of history.

Cheers

Answer: D They emphasize the idea that bicycles helped blur gender roles.

Explanation:

Which sentence in this excerpt from a review of the film The Avengers makes for a strong thesis statement supported by the text?
Everybody has been waiting for the release of the much-hyped The Avengers movie. Writer/director Joss Whedon has done an excellent job showcasing the different heroes’ strengths and weaknesses. The movie’s chief attribute lies in its ability to tell the larger-than-life stories of its protagonists while simultaneously grounding them with human traits. Whedon doesn’t present his heroes as being infallible. Instead, they’re flawed humans with strengths, weaknesses, and vulnerabilities. These qualities make the characters easy for the average person to identify with.Whedon has vividly portrayed the internal struggles that his heroes undergo in their quest for self-realization. The film also has supernatural entities such as gods and demigods. However, at its heart, this is a story of ordinary people thrust into extraordinary situations.

Answers

Answer:

The movie’s chief attribute lies in its ability to tell the larger-than-life stories of its protagonists while simultaneously grounding them with human traits.

Explanation:

hope this helped

One of the other employees in your department did not show up for work. He will not be coming in today, and no one will be arriving to replace him. Unfortunately, the department's workload has not changed. What is the most appropriate way to handle this situation?


A. Continue on your own and let your supervisor handle the situation.

B. Meet with your department employees and spread out the extra work among them.

C. Call the employee who did not show up and convince him to come to work anyway.

D. Ask employees from other departments if they could help with the extra workload.

Answers

Answer:

B

Explanation:

Its an appropriate response to the situation

B. It is reasonable so everyone has equal work

In about two hundred words, explain how the literary devices used in the novel convey theme. (Things Fall Apart)

Answers

Answer:

....literary devices used in the novel convey theme. in two hundred words...*two hundred words*

Explanation:

JK JK lol

What are literary devices?

Literary devices are various elements and techniques used in writing that construct the whole of your literature to create an intended perception of the writing for the reader. Like personification, foreshadowing, and metaphors in school. While these are very common types of literary elements, there are many more you can use to make your writing stand out in comparison to others. You don’t have to know every single literary term in order to be considered a writer. In fact, most people are writers before they discover the detailed nuances of writing.  There’s no need to use every single literary device, but by knowing what’s available for you to use and how to use it strategically, your writing will become stronger and therefore, more captivating to readers. Tone can guide your readers right into the emotion you want them to feel in a particular scene.

Literary devices are techniques or elements used by authors to enhance their writing and convey their intended message to the reader. To explain this, the author could have provided examples of specific literary devices used in the novel, such as symbolism, imagery, irony, or foreshadowing. They could have discussed how these devices are used to develop and reinforce the theme of the novel. For example, in "Things Fall Apart," the author Chinua Achebe uses symbolism to convey the theme of cultural clash and the impact of colonization. The character of Okonkwo, the protagonist, symbolizes traditional African values and the struggle to maintain them in the face of European colonialism. Through Okonkwo's personal journey, Achebe highlights the tensions between traditional African culture and the encroachment of Western influence. Additionally, the author could have explained how imagery is used in the novel to evoke emotions and enhance the reader's understanding of the theme. For instance, Achebe's vivid descriptions of the African landscape and the rituals and customs of the Igbo people create a rich sensory experience for the reader, immersing them in the world of the novel and deepening their connection to the themes explored. By providing specific examples and discussing how these literary devices contribute to the overall theme of the novel, the answer would have been more detailed and comprehensive. This would have helped the reader gain a deeper understanding of how the author conveys their message through the use of literary devices in "Things Fall Apart".

247 words. Your Welcome <3

Which two factors combine to form an author’s purpose for writing a text?

audience and message
imagery and repetition
narrator and narrator's point of view
tone and word choice

Answers

Answer:

audience and message.

Explanation:

he two factors that combine to form an author's purpose for writing a text is audience and message.

Answer:

audience and message

Explanation:

got it right

The first literary period studied in American Literature is a the Enlightenment period b the Colonial period c the Explorers d the Native Americans

Answers

The Colonial and Early National Period (17th century to 1830) The first European settlers of North America wrote about their experiences starting in the 1600s. This was the earliest American literature.

PLZ FINISH THE SENTENCE
The old SAGE advised his young apprentice to…
what does the word in all caps mean in this sentence?

Answers

Answer:

sage means like an experienced old geezer who has seen it all.

Explanation:

it also means a bit sarcastic so like... "I love the pandemic" she said sagely. which obvi no one likes the pandemic

word for someone who does something they said they wouldn't do

Answers

Answer:

liar

Explanation:

Answer:

Hypocrite, liar

Explanation:

Based on what you know about the other words in this sentence, can you infer the meaning of the underlined word?
When I tried to sneak out of the house, my mother called to me to get back inside with a seemingly omnipotent power, as I opened my window
a.
super
c.
effortless
b.
all-knowing
d.
none of the above


Please select the best answer from the choices provided

A
B
C
D

Answers

Answer:

c effortless

Explanation:

not a not b and not d

Answer:

correct, c

Explanation:

got it right

The grand mother was happier in
A. town
B.village
 C.tree
D.field​

Answers

Answer:

In what text are we talking about?

Explanation:

We need to know what text your talking about to understand your question.

The answer would be B.village

he took me to dinner for my birthday what is the pronoun in he

Answers

Answer:

he

Explanation:

Answer:

He is a pronoun

Explanation:

I hope it will help you

What statement supports the idea that oaks are usually a hearty tree? A. They can be found mostly in northern temperate zones but grow equally well in warm states such as California B. Oaks are the genus Quercus which comes from the Latin term meaning fine tree C. One of the most majestic trees is the oak tree D. By the time the oak is 70 to 80 years old you'll make thousands of acorns every year

Answers

Answer:

I believe the statement which supports the idea that oaks are usually a hearty tree is:

C. One of the most majestic trees is the oak tree.

Explanation:

We can reach the conclusion above if we work with definitions and synonyms.

"Hearty" means, among other things, large or great. The adjective "majestic" is used to refer to something that inspires admiration or respect due to its size, beauty, or power. As we can see, both "hearty" and "majestic" are used to refer to the size of something, which means they can work as synonyms. Therefore, the statement that supports the idea that oaks are usually a hearty tree should be:

C. One of the most majestic trees is the oak tree.

What appeal did the revisions to the declaration strengthen or improve?

Answers

Answer:

LOGOS

Explanation:

Answer:

Logos

Explanation:

I just took the quiz

Write a
complete summary of "The Wind and the Sun." Include ALL the necessary details.

Answers

Answer:

The wind and the sun argued one day over which one was the stronger. Spotting a man man traveling on the road, they sported a challenge to see which one could remove the coat from the man's back the quickest.

   The wind began. He blew strong gusts of air, so strong that the man could barely walk against them. But the man clutched his coat tight against him. The wind blew harder and longer, and the harder the wind blew, the tighter the man held his coat against him. The wind blew until he was exhausted, but he could not remove the coat from the man's back.

    It was now the sun's turn. He gently sent his beams upon the traveler. The sun did very little, but quietly shone upon his head and back until the man became so warm that he took off his coat and headed for the nearest shade tree.

Explanation:

Look at the signs and symbols below. Write a sentence for each picture using modal verbs.

thank you agad sa makakasagot

Answers

Answer:

Picture 1: You must wash your hands under running water for at least 20 seconds.

Picture 2: Mr. Ken will not be allowed into the hall if he is not with face mask.

Picture 3: You may not stay there again.

Picture 4: Mother said you should maintain social distancing with everyone.

Picture 5: You can't smoke in this premises because it is prohibited.

Picture 6: Mary might be injured if she goes into the workshop without facemasks and gloves.

Picture 7: The child could have be poisoned with the prohibited chemical.

Picture 8: Cynthia ought to bath after the day's work.

Picture 9: She would be stopped at the entrance.

Picture 10: The photograper shouldn't bring his camera.

Explanation:

These sentences have been written in relationship to the images above.

please I need the answer​

Answers

Answer:

a. for

b.for

c.till

d.since

Explanation:

.

People refuse to recognize the danger of ear buds because they simply love their ear buds too much to give them up. Ear buds are probably doing serious physical damage to their inner eardrums or even the brain itself, but apparently that doesn’t bother anyone. I shudder to think of what the future will be like if we continue on the path of ear bud slavery we’re traveling. Next time you’re tempted to plug in and tune out, remember my warning. Either we learn to live without ear buds, or we’re going to turn into a nation of complete zombies. Is that where you want to live?
The author concludes that because of the dangers ear buds present, they should be tossed into the trash or, at least, never used. What would be a more moderate conclusion for him to make?

A) that all ear buds be destroyed immediately
B) that only live music be legal, and all other forms outlawed
C) that all music be banned from being played at any large, social event
D) that people learn to use their ear buds safely, without endangering themselves or others

Answers

Answer:

The answer has be D. because  he does not say to ban music or to destroy all ear buds, or even outlawed, he is warning the dangers

Explanation:

parenting examples in chapter 3 of the killers tears

Answers

Explanation:hey

stop cheating you need a photo for the question that your asking

please help it’s due tomorrow...picture attached

Answers

Answer:

2. Innocence is basically purity or being positive or lay low someone who is innocent would be my little brother or sister or little kids because they don't really know much and their minds are pure.

4. Justice is having your word get out and get credit for it or having some type of freedom. the most unjust occurrence I've ever heard about is my friend being followed around a nice store and being told the prices of the things and being told " are you sure you can afford this" all I have to say is don't judge a book by its cover.

Explanation:

Which sentence contains a comma splice?

Answers

The answer is the first option because it includes two independent clauses and is not corrected combined

Make a list of the six parts of a business letter in the order in which they appear.

1. The

2. The

3. The

4. The

5. The

6. The

Answers

Answer:

the principal,the teacher,the co-worker,the neighbor,the restaurant,and the manager

Explanation:

Answer:

1. The  

Heading

2. The  

Inside Address

3. The  

Salutation

4. The  

Body

5. The  

Closing

6. The  

Signature

Explanation:

Heading:  the writer's address and the date the letter is written

Inside Address:  the name, title, and address of the person to whom he is writing

Salutation:  the greeting that follows the inside address

Examples: Dear Sir:

Dear Ms. Smith:

Dear Editor:

Body:  the paragraphs of the letter

Closing:  follows the body, begins with a capital and ends with a comma

Examples: Very truly yours,

Sincerely,

Respectfully,

Signature:  identifies who wrote the letter by signed and typed name                                                                                                                           DONT COPY ME PLZ GIVE BRAINLYEST

What does the word homage mean based on the context clues provided?

Mark paid homage to his grandmother by entering the annual cooking contest, just as she had done for years.

A.
to follow along
B.
to show respect
C.
to live with
D.
to replace someone
Reset Next

Answers

Answer: B

Explanation:

Answer:it’s not b

Explanation:

How will you handle a bullying situation?

What type of bystander will you of ​

Answers

I would go up to the bully and wack him with my wrench

Answer:

If I am a bystander, witnessing bullying, I will attempt to diffuse the situation without putting myself in harms way. I would say things like "please stop" "let's talk this out" etc...If this fails i will report the incident to a teacher or trusted adult and allow them to take over.

Explanation:

PLEASE ANSWER ASAP


Read this excerpt from the introduction to Wheels of Change by Sue Macy.


When I was a kid, I took great pleasure in jumping on my bike and riding to the corner candy store about half a mile away. Although I had no knowledge of the part the bicycle had played as a vehicle of change for turn-of-the-20th-century women, I was acutely aware that it allowed this 1960s girl a unique measure of independence. On my bike, I could break free of the bonds that held me in my neighborhood to go buy Necco Wafers and candy necklaces and Atomic FireBalls. If I felt particularly adventurous, I could even ride a bit farther for a fresh ice-cream cone at Applegate Farm.


The author’s purpose for including this in the introduction is


A. to describe the research she conducted for Wheels of Change.

B. to explain the historical significance of bicycles.

C. to establish her credentials as an expert on bicycles.

D.to emphasize her personal appreciation for bicycles.

Answers

Answer:

B.

Explanation:

Answer:

b

Explanation:

How has past informed present or future choices?

Answers

oh myself and the rest i was a great day!.

Answer:

More factories were made which made lots and lots of pollution and if more are made the world may die including everyone on it. Also trees were taken down which gave us less oxygen.. Were all dying breathing in the pollution and letting litter get out into the ocean, help save the planet, pls it's the only one we can live one

Explanation:

Melville's description of Ahab's scar in this excerpt best develops which theme in the novel? the ability of man to let go of past wounds the harmony that exists between man and nature the ruling of man's present by his past wounds the destructive power of man's technologies

Answers

Answer:

Melville's description of Ahab's scar in this excerpt best develops the theme of the ruling of man's present by his past wounds

Explanation:

The question is not complete since it does not provide the complete information to be answered. Here is the full information:

Read the excerpt from Chapter 28 of Moby D ick.

It resembled that perpendicular seam sometimes made in the straight, lofty trunk of a great tree, when the upper lightning tearingly darts down it, and without wrenching a single twig, peels, and grooves out the bark from top to bottom, ere running off into the soil, leaving the tree still greenly alive, but branded.

Melville’s description of Ahab’s scar in this excerpt best develops which theme in the novel?

The ability of man to let go of past wounds

The harmony that exists between man and nature

The ruling of man’s present by his past wounds

The destructive power of man’s technologies

The description that is being given in this excerpt talks about a wounded tree when in fact is talking about how a person is marked by their experiences in life and even when they might look strong in the outside there is an inner force that comes from that moment in their past that drives them into the person they are now, making their present affected by the experiences in the past.

Answer:

c the ruling of man’s present by his past wounds

Explanation:

c the ruling of man’s present by his past wounds

I need ideas for an essay....
I believe_________
Any ideas?

Answers

I believe success comes from failures. (or something that goes along with that)


You can write about in your paragraphs:

-How failures help you learn new things that’ll guide you to where you want to succeed.

-How failures and getting through obstacles can keep on pushing you to your goals.

Which blog is most likely intended to inform readers?

a blog asking people to volunteer at a school fundraiser
a blog explaining how to build a skateboard ramp
a blog arguing for a new community theater
a blog describing the funny actions of a pet parrot

Answers

Answer:

B. A blog explaining how to build a skateboard ramp

Explanation:

The three other options reveal a motive other than to inform.

The first option is intended to recruit volunteers.

The third option is intended to further agenda (the construction of a new community theater)

The fourth option is intended to entertain.  

Only the second option, a blog explaining how to build a skateboard ramp, is motivated by a desire to inform readers.

Answer:

a blog explaining how to build a skateboard ramp

This one will inform on how to build ramp.

a blog asking people to volunteer at a school fundraiser is one that is just asking someone to do something

a blog arguing for a new community theater and a blog describing the funny actions of a pet parrot are opinion blogs. So i'd go with a blog explaining how to build a skateboard ramp

Advantages Disadvantages Millions of users are able to be connected at one time. • A variety of files can be shared, including music, games, videos, and software. Personal information can be copied by others • People could accidentally break copyright laws and face legal trouble. People could download a harmful computer virus DEL LLI 1. Which fact could be used to complete the chart? (7 point) Steps can be taken to protect personal information It is best to close your file-sharing connection when it is not in use. Breaking copyright laws can result in hefty fines or even jail time. Internet file sharing is often free and typically very easy to access. ​

Answers

Answer:

its d Internet file sharing is often free and typically very easy to access.

Explanation:

Answer: Its D

Explanation:

On Edge 2020

Other Questions
PLEASE HELP ASAP 5 STARS AND BRAINLIEST TO WHOEVER DOES ALL OF THE PAGE The majority of Canadians live in rural areas. True or False Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies